(data stored in ACNUC7421 zone)

EMBL: CP001854.PE252

CP001854.PE252       Location/Qualifiers
FT   CDS_pept        complement(259678..260910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0252"
FT                   /product="protein of unknown function DUF405"
FT                   /note="PFAM: protein of unknown function DUF405; protein of
FT                   unknown function DUF418; KEGG: bbr:BB3226 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48688"
FT                   /db_xref="GOA:D3F615"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F615"
FT                   /inference="protein motif:PFAM:PF04171"
FT                   /protein_id="ADB48688.1"
FT                   /translation="MLSPPAPATPPAVPPARRIAAVDALRGFALLGILVVNITFFGSAF
FT                   TLYEVPDPAFSSPLDDAANWFVAVFFTSKFYVLFSFLFGYSFTLQIDAAVRRGAAFVPR
FT                   FLRRLLGLFAIGAAHAVLLWQGDILTTYAVLGLVLLALRGLEPRRAVRIAVVLLLLSAS
FT                   FFALAGLDELSRGVEADTAQRVADATAATDAWRGSIGEVISQRISELPTVAGVIGLLQA
FT                   PTALAMFLLGLAAGKRRLFADLDALRPHLRRMVRIGLPVGLAGSVVYTYLTIEHAGTGW
FT                   ATFAVAFDVLTAPLLSAAYAAVLLLAVQARHGHRLTAVLAPTGRMALSNYLLQSIACCL
FT                   IFTGYGLGLVGRLAPAAVLGVAAAVYAAQLATSAWWLGRHPYGPAEWLLRGFTNWSRPR
FT                   WRLPPPPRPGA"
     atgctctcgc cacccgcgcc cgcgaccccg cccgccgtcc cgcccgctcg ccggatcgcc        60
     gccgtcgacg ccctgcgcgg cttcgccctg ctcgggatcc tcgtcgtcaa catcaccttc       120
     ttcggctccg ccttcacgct ctacgaggtc ccggatcccg ccttctcctc gccgctcgac       180
     gacgccgcca actggttcgt cgccgtcttc ttcacgtcga agttctacgt cctcttctcg       240
     ttcctgttcg gctacagctt cacgctccag atcgacgccg cggtccgccg cggcgccgcg       300
     ttcgtgccgc gcttcctgcg gcggctgctc ggcctcttcg cgatcggcgc cgcgcacgcg       360
     gtgctgctgt ggcagggcga catcctcacg acgtatgccg tgctgggact cgtcctgctc       420
     gcgctgcgcg ggctggagcc gcggcgcgca gtccgcatcg cggtcgtgct gctgctgctc       480
     agcgcgagct tcttcgcgct cgccggcctc gacgagctgt cacgcggggt cgaggccgac       540
     accgcccagc gcgtcgccga cgcgaccgcg gcgacggacg cctggcgcgg ctcgatcggc       600
     gaggtgatct cgcagcgcat cagcgagctg ccgactgtcg ccggggtgat cgggctgctg       660
     caggcgccga ccgcgctggc gatgttcctg ctcggcctcg cggccggcaa gcggcgcctg       720
     ttcgcggacc tcgacgcgct gcgaccgcac ctgcgccgga tggtgcggat cggcctcccg       780
     gtcgggctcg caggctccgt cgtctacacg tatctgacga tcgagcacgc tggcacgggg       840
     tgggcgacgt tcgcggtcgc gttcgacgtg ctgaccgcgc cgctgctgtc ggctgcctac       900
     gcggccgtgc tgctgctcgc ggtccaggcg cggcacggcc accggctgac ggccgtgctc       960
     gccccgacgg gccggatggc gctgtcgaac tacttgctgc agtcgatcgc ctgctgcctg      1020
     atcttcaccg gctacgggct cggcctcgtc ggccggctcg cgccggccgc cgtgctcggc      1080
     gtcgccgccg ccgtctacgc ggcccagctc gcgaccagcg cctggtggct gggccgccat      1140
     ccgtacggcc cagccgagtg gctgctgcgc gggttcacga actggtcgcg tcctcgctgg      1200
     cggctccctc cgccgcctcg gccaggcgct tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page