(data stored in ACNUC7421 zone)

EMBL: CP001854.PE253

CP001854.PE253       Location/Qualifiers
FT   CDS_pept        complement(261024..261680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0253"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: scl:sce5431 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48689"
FT                   /db_xref="GOA:D3F616"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F616"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48689.1"
FT                   /translation="MSPALRVVVADDHALARAGVRMILESQPDIAVVGEAGDGHAAVAA
FT                   ADRLRPDVVLMDTHLPRLDGVAATRRLAAHRVLLLTSGSPEERLVEALRAGARGFLLKH
FT                   ASAGDLVAAVRAVAAGDMLLSPAATRALFERIAPMLHLDAAPPPSALGELTERELDVLR
FT                   LLARGLSNGEIAAQLFVSGATVKTHVSHLLRKLCLRDRVQAVVFAYDSGLVQPRG"
     gtgagtccgg cattgcgcgt ggtcgtcgcc gacgaccacg cgctcgcgcg ggccggcgtc        60
     cgcatgatcc tggagtcgca gcccgacatc gccgtcgtcg gcgaggccgg cgacggccac       120
     gccgcggtcg ctgcggccga ccggctgcgc ccggacgtcg tgctgatgga cacgcacctg       180
     ccgcggctcg acggcgtcgc cgcgacacgc cggctcgccg cccatcgcgt gctgctgctg       240
     acctccggct ccccggagga gcggctcgtc gaggcgctgc gggccggcgc gcgcggcttc       300
     ctgctcaagc acgcgtcggc cggcgacctc gtcgccgccg tgcgcgcggt cgccgccggc       360
     gacatgctgc tctcgccggc cgcgacgcgc gcgctgttcg agcggatcgc cccgatgctg       420
     cacctcgatg cggcgccgcc gccgagcgcg ctcggcgagc tgaccgagcg cgagctggac       480
     gtgctgcgcc tgctcgcgcg cgggctgtcg aacggcgaga tcgcggcgca gctgttcgtc       540
     agcggtgcga cggtcaagac gcacgtctcg cacctgctgc gcaagctctg cctgcgcgac       600
     cgcgtgcagg cggtcgtctt cgcctacgac agcggactcg tgcagccgcg cggctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page