(data stored in ACNUC7421 zone)

EMBL: CP001854.PE254

CP001854.PE254       Location/Qualifiers
FT   CDS_pept        complement(261677..262273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0254"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_1087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48690"
FT                   /db_xref="GOA:D3F617"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D3F617"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48690.1"
FT                   /translation="MTPSPVDHDARREQLTRVLLALVAERGLEGASVRAVASAAGVSIG
FT                   TVQHYFRSKDEMLLFAFRQTGSDLTERAERIARRALSVRAAIRGILLELLPLDARREAE
FT                   ARVGIAFAAHAMTAPRLAGVLRDDLDELRRELADAFAQAKVADPPQAASAAMALVDGLA
FT                   TQLLFGSAAFGADDAVAVLDAHLEHALARRRRRRA"
     atgacaccgt cgccggtcga tcacgatgcg cgccgcgagc agctcacacg cgtgctgctg        60
     gcgctcgtcg ccgagcgcgg gctggagggc gcgagcgtgc gtgccgtcgc gtccgcggcg       120
     ggcgtctcga tcggcacggt gcagcactac ttccgctcga aggacgagat gctgctgttc       180
     gccttccggc agacgggcag cgacctgacc gagcgcgccg agcggatcgc gcgccgagcg       240
     ctgagcgtgc gcgcggcgat ccgcgggatc ctgctcgagc tgctgccgct cgacgcgcga       300
     cgcgaggccg aggcgcgcgt ggggatcgcg ttcgccgcgc acgcgatgac cgcgccgaga       360
     ctcgccgggg tcctgcgcga cgacctcgac gagctgcgcc gggagctggc ggacgcgttc       420
     gcgcaggcga aggtcgccga cccgccgcag gcggcgtccg cggcgatggc gctcgtcgac       480
     ggcctcgcga cgcagctgct gttcggcagc gccgcgttcg gtgccgacga cgcggtcgcc       540
     gtgctcgacg cgcacctgga gcacgcgctc gcccgccgtc ggcggagacg cgcgtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page