(data stored in ACNUC7421 zone)

EMBL: CP001854.PE255

CP001854.PE255       Location/Qualifiers
FT   CDS_pept        complement(262328..263791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0255"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A3935 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48691"
FT                   /db_xref="GOA:D3F618"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F618"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48691.1"
FT                   /translation="MSSQHNTSSPHHARRWWVLALIGVAQLMVVLDATIVNIALPSAQS
FT                   ALEFSDANRQWIVTAYALAFGSLLLIGGRIGDLFGRKRVFIAGLLGFAVASAIGGAAQS
FT                   FGMLVFARALQGVFGALLAPAALSLLTTTFTDPGERGRAFGIFGAIAGSGAAIGLLLGG
FT                   VLTEYLSWRWCLYVNLLFAVPTAFAAITLLHDEAHPAKPRLDIPGTLTSALGLFALVYG
FT                   FAEAESEGWGASTTIAFLAAGVALLAVFVWLQTRTEHPLLPLRVVRDRDRGGAYFAIGI
FT                   TGAGMFGVFLFLTYYLQQTLGFSPVETGLAFLPLSFAIMLTATSATAQLMPRFGHKPLI
FT                   VTGLAMSAAGMVLLAQVGVDSEYLTHVLPGLVVMGLGLGLVFAPGMSIATIGVDPHDAG
FT                   VASAMVNTTQQVGGSIGTALLSTLFASAVSGFIADNGPRAAGEAAVHGYTTAFWWSAAI
FT                   FAVGAVVSLLLLKSGVKQADPAAEPVLVH"
     atgtcctccc agcacaacac ctcctctcca caccatgcac gccgttggtg ggtcctggcg        60
     ctgatcggcg tcgcccagct gatggtcgtg ctcgacgcga cgatcgtgaa catcgcgctg       120
     ccctcagcgc agtcggcgct ggagttctcc gacgccaacc ggcagtggat cgtcaccgcc       180
     tatgcgctcg cgttcggctc actgctgctg atcggaggcc gcatcggcga cctcttcggc       240
     cgcaagcgcg tcttcatcgc cggcctgctc ggcttcgccg tcgcctccgc gatcggcggc       300
     gccgcgcaga gcttcggcat gctcgtcttc gcccgcgcgc tgcagggcgt cttcggcgcg       360
     ctgctggcgc cggccgcgct gtcgctgctg acgaccacgt tcaccgatcc cggcgagcgc       420
     ggcagagcgt tcggcatctt cggcgcgatc gccggctccg gcgccgcgat cggcctgctg       480
     ctcggcggcg ttctgaccga gtacctctcc tggcgctggt gcctctacgt caacctgctg       540
     ttcgccgtcc cgaccgcgtt cgccgcgatc acgctgctgc acgacgaggc gcacccggcc       600
     aagcccagac tcgacatccc cggcacgctc acctccgcgc tcggcctgtt cgcgctcgtc       660
     tacggcttcg ccgaggcgga gagcgagggc tggggcgcga gcacgacgat cgcgttcctc       720
     gccgccggcg tcgcgctgct cgcggtcttc gtctggctcc agacgcgcac cgagcacccg       780
     ctgctgccgc tgcgcgtcgt gcgcgaccgc gaccgcggcg gtgcgtactt cgcgatcggg       840
     atcaccggcg cgggcatgtt cggcgtcttc ctgttcctga cctactacct ccagcagacg       900
     ctcggcttct caccggtcga gaccggtctc gcgttcctgc cgctgagctt cgcgatcatg       960
     ctgacggcga cgagcgcgac ggcgcagctg atgccgcggt tcgggcacaa gccgctgatc      1020
     gtgaccgggc tcgcgatgtc ggcggccggg atggtgctgc tcgcacaggt cggcgtcgac      1080
     agcgagtacc tcacgcatgt gctgccgggc ctcgtcgtga tggggctcgg gctcgggctc      1140
     gtgttcgcgc ccgggatgag catcgcgacg atcggcgtcg acccgcacga cgccggcgtc      1200
     gcctccgcga tggtgaacac gacgcagcag gtcggcgggt cgatcggcac cgcgctgctc      1260
     agcacgctgt tcgccagcgc cgtgtcgggc ttcatcgccg acaacggccc gcgtgcggcc      1320
     ggcgaggccg ccgtgcacgg ctacacgacc gcgttctggt ggtcggccgc gatcttcgcg      1380
     gtcggcgcag tcgtctcgct gctgctgctc aagtccggcg tcaagcaggc cgacccggcc      1440
     gcggagccgg tgctggtgca ctag                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page