(data stored in ACNUC7421 zone)

EMBL: CP001854.PE256

CP001854.PE256       Location/Qualifiers
FT   CDS_pept        263927..264610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0256"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ara:Arad_4588
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48692"
FT                   /db_xref="GOA:D3F619"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3F619"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48692.1"
FT                   /translation="MSTAAEPARDRPLRRDAERNRRRILDAATEVFADRGLGVTMDDIA
FT                   AHAGVGVGTVYRRFANKDQLIDALFYERIDALARLGEEGLTHADAWEGLVFFMEEAIGQ
FT                   QARDRGLKELLFGSGRGEERVAHARTRMAPVVFALVDRARAAGVLRPDVEGTDVPVLQL
FT                   MLGTVVDFSRDVEPELWRRYLTLMLDGLRVRRDDDTPLPLPPLDEHGTERAMASWQVPR
FT                   RGPVS"
     atgagcaccg ccgccgagcc cgcccgcgac cgccccctgc ggcgcgacgc cgaacgcaac        60
     cggcggcgga tcctcgacgc ggcgaccgag gtgttcgcgg accgcggcct cggcgtcacg       120
     atggacgaca tcgccgccca cgcgggcgtc ggcgtcggca ccgtctaccg ccgcttcgcg       180
     aacaaggacc aactgatcga cgcgctcttc tacgagcgca tcgacgcgct cgcgcggctc       240
     ggcgaggagg gcctcacgca cgccgacgcg tgggaggggc tcgtcttctt catggaggag       300
     gcgatcggtc agcaggcgcg cgatcgcggc ctcaaggagc tgctgttcgg cagcggccgc       360
     ggcgaggagc gcgtcgccca cgcgcgcacg cggatggcgc cggtcgtctt cgccctggtc       420
     gaccgcgccc gcgccgccgg cgtgttgcgc cccgacgtcg agggcaccga cgtccccgtc       480
     ctgcagctga tgctcggcac cgtcgtcgac ttctcacgcg acgtcgagcc ggagctgtgg       540
     cgccgctacc tcacgctgat gctcgacggc ctgcgcgtcc gtcgagacga cgacacgccg       600
     ctgcccctgc ccccgctcga cgagcacggg accgagcggg cgatggcctc ctggcaggtc       660
     ccgcgccgcg gacccgtcag ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page