(data stored in ACNUC7421 zone)

EMBL: CP001854.PE258

CP001854.PE258       Location/Qualifiers
FT   CDS_pept        complement(264819..265190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpu:KP1_3163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48694"
FT                   /db_xref="UniProtKB/TrEMBL:D3F621"
FT                   /inference="similar to AA sequence:KEGG:KP1_3163"
FT                   /protein_id="ADB48694.1"
FT                   /translation="MPWPPAIGDLLPLAEHACGIRRKLLTYSLAHEHERGGDKARAFLL
FT                   ALSIERAHVDHLEAELRAGVRVTPISRVDVKRHGFLFQVRIPVRGVMLHRNRVLPVTTG
FT                   WHVPEEGMAPRLASAYLKS"
     atgccctggc cacccgcgat cggcgacctc ctcccgcttg ccgagcacgc ctgcggcatc        60
     cgccggaagc tgctcacgta cagcctcgcc cacgagcacg aacgaggcgg cgacaaggcg       120
     cgcgcgttcc tgctggcgct ctcgatcgag cgcgcgcacg tcgaccatct cgaggcggag       180
     ctgcgggccg gggtgcgcgt cacgccgatc agtcgagtgg acgtcaagcg gcacggattt       240
     cttttccagg ttcgaatccc agtccgtggc gtcatgctcc accggaatcg agttcttcca       300
     gtcacaacgg gctggcatgt accggaggaa ggcatggcgc cgcgactcgc atccgcctat       360
     ctcaagagct aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page