(data stored in ACNUC7421 zone)

EMBL: CP001854.PE259

CP001854.PE259       Location/Qualifiers
FT   CDS_pept        265428..266882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0259"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: peptidase S41; KEGG:
FT                   hch:HCH_04120 periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48695"
FT                   /db_xref="GOA:D3F622"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3F622"
FT                   /inference="protein motif:PFAM:PF03572"
FT                   /protein_id="ADB48695.1"
FT                   /translation="MIRSPHPAARRAVRLTAATAALTFALSAAACQLDVDTSDAATTAP
FT                   AARDAPQLAGTWRSVGYGWALEARGARIRMYDVTRSGCTPASVFRAHARGAAVRLTATD
FT                   GWGALDAVAGRRAGSVVLRPVGSVGVVTLRRIRRPPARCDAAPHRDQRATTRALTETFA
FT                   EQYPFFARRGVDWRRTTRALERATRTPLPPKQLFELYRRALAPLHDAHVSLLDPGSETE
FT                   WTGRRPDPHPLAPADHARIQQIVETRLGARLRSFANGRIFYARTHSGIGYLRIVSFGGY
FT                   ARAAATADGSRRDAQVLARTLDGILGGADAPRSGLLVDVRENVGGYDALQLVVAARLTA
FT                   TRYLAFRKATQISGGRTPRRTRPQAIDVVPAAGRPGWHGPVALLTGRDTESAGETFVLS
FT                   LIGRTPAVARIGETTQGVFSDQLVRRLPNGWTFGLPSEIYTAPDGTVYEGRGIPPTDAQ
FT                   PVFTPEDLATRRDPALERALSALGGR"
     atgatccgat cgccccaccc ggccgcgcgc cgcgccgtcc gcctcacagc ggcgacggcg        60
     gcattgacgt ttgcgctcag cgccgccgcg tgccagctcg acgtcgacac gtcggacgcg       120
     gcgacgaccg cgcccgcggc gcgggatgcg ccgcagctcg ccggcacgtg gcgtagcgtc       180
     ggctacggct gggcgctgga ggcgcgcggc gcgcgcatcc ggatgtacga cgtgacgcgc       240
     tccggctgca cgcccgcgag cgtgttccgc gcccatgcgc gcggcgcggc ggtgcggctc       300
     accgcaaccg acggctgggg tgcgctcgac gccgttgccg gcagacgcgc tggcagcgtc       360
     gtcctgcggc cggttggctc ggtcggcgtc gtcacgctgc ggcgcatcag gcggccgccg       420
     gcccgctgcg acgccgcgcc gcaccgcgat cagcgcgcga cgacgcgggc gctgacggag       480
     accttcgccg agcagtaccc gttcttcgcg cggcgcgggg tcgactggcg gcgcaccacc       540
     cgcgcgctcg agcgcgcgac gcgcacaccg ctcccgccga agcagctgtt cgagctgtac       600
     cggcgcgcgc tggcgccgct gcacgacgca cacgtctcgt tgctggaccc gggcagcgag       660
     accgagtgga ccggtcgcag accggacccg catccgctcg caccggccga ccacgcgcgc       720
     atccagcaga tcgtcgagac gcggctcggc gcgagactgc gcagcttcgc gaacggccgc       780
     atcttctatg cgcgcacgca cagcggcatc ggctatctgc ggatcgtctc gttcggcggc       840
     tacgcgcgcg ccgccgccac cgccgacggt tctcgccggg acgcgcaggt cctcgcccgc       900
     acgctcgacg ggatcctcgg cggcgccgac gcgccgcgca gcggtctcct cgtcgacgtg       960
     cgcgagaacg tcggcggcta cgacgcgctc cagctcgtcg tcgcggctcg tctcaccgcg      1020
     acgcgctacc tcgccttccg caaggcgacg cagatctcgg gcgggaggac gccccgacgc      1080
     acccggccgc aggcgatcga tgtcgtcccc gccgccggcc gcccgggctg gcacgggccg      1140
     gtcgcgctgt tgaccggtcg cgacaccgag agcgccggcg agacgttcgt gctgtcgctg      1200
     atcgggcgca cgccggccgt cgcgcggatc ggcgagacga cccagggcgt cttctccgac      1260
     cagctcgtgc gccggctgcc gaacggctgg acgttcggtc tcccgtcgga gatctacact      1320
     gcgcccgacg gcaccgtgta tgaagggcgc ggcatcccgc cgaccgacgc gcagcccgtc      1380
     ttcaccccgg aggaccttgc cacccgtcgc gaccccgccc tcgaacgagc gctctccgca      1440
     ctcggcgggc gctga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page