(data stored in ACNUC7421 zone)

EMBL: CP001854.PE26

CP001854.PE26        Location/Qualifiers
FT   CDS_pept        complement(28889..29587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0026"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ppd:Ppro_3448
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48462"
FT                   /db_xref="GOA:D3F3X9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X9"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48462.1"
FT                   /translation="MERGLYIAASGMIAEQMRQDAIANDLANASTPGYKADRITQASFG
FT                   DLLLSNSNTGQVIGPLGTGAYADSKVTDLRPQATRVTEEPLDLAIVGEGWFGVQTPEGV
FT                   RYTRNGQFSASPQGQLIDQLGRPVLGPGGQPVQLDARGHVRPGSVGVFALANARKEGDN
FT                   YFTGAAGGQATGQVEIGALEGSGIDPTRTMVDMIASFRAYEAGQKVITTIDDTLRRTST
FT                   QVGNATGGSF"
     atggagcgtg gtctctacat cgccgcctcg ggcatgatcg ccgagcagat gcggcaggac        60
     gcgatcgcga acgacctcgc gaacgcctcc acccccggct acaaggccga ccgcatcacg       120
     caggcgagct tcggcgacct gctgctgtcg aactcgaaca ccggccaggt gatcgggccg       180
     ctcggcaccg gcgcctacgc ggactcgaag gtcaccgacc tcagaccgca ggcgacgcgc       240
     gtcaccgagg agccgctcga tctcgcgatc gtcggcgagg gctggttcgg cgtgcagacg       300
     ccggagggcg tgcgctacac ccgcaacggc cagttcagcg cctcgccgca gggtcagctg       360
     atcgaccagc tcggccgtcc cgtgctcggt cccggcggcc agccggtgca gctcgacgcg       420
     agaggccatg tgagacccgg cagcgtcggc gtcttcgcgc tcgccaacgc ccgtaaggag       480
     ggcgacaact acttcacggg cgccgctggc ggccaggcca ccggccaggt cgagatcggc       540
     gcgctcgaag gctcgggcat cgacccgacc cgcacgatgg tcgacatgat cgcctccttc       600
     cgcgcctacg aggccggcca gaaggtgatc acgacgatcg acgacacgct gcgccgcacg       660
     tcgactcagg tcggcaacgc gaccggcggc tccttctag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page