(data stored in ACNUC7421 zone)

EMBL: CP001854.PE260

CP001854.PE260       Location/Qualifiers
FT   CDS_pept        266898..267629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48696"
FT                   /db_xref="UniProtKB/TrEMBL:D3F623"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48696.1"
FT                   /translation="MTARLVAVVVLALVAASGFVLAARVRTVGDTTALHTLPAPERLTI
FT                   DDEEGDVAVVAEARDDVLVETRSRWTGARPAARVAAGGDVLRLTGRCDRLDVRLVASRD
FT                   WRWGSECAVSYRVRVPVGLDVRVSTGTGDVRLVGLAGAIDAEAHDGDVTAVGLRSPHVT
FT                   LRATGAGAIRARFAAVPGAVDARAEGGAVRLALPPGRYHLSADAPRGRTWIGAGIDADP
FT                   AGRSTVGASAGDGDVTVEAAR"
     atgacggccc ggctcgtcgc ggtcgtcgtg ctcgcgctcg tcgcggccag cggcttcgtg        60
     ctcgccgccc gcgtgcggac ggtcggcgac acgacggcgc ttcacacgct ccccgcaccg       120
     gagcggctga cgatcgacga cgaggagggc gacgttgccg tcgtcgccga ggcccgcgac       180
     gacgtgctcg tcgagacgcg ctcgcgctgg accggcgcgc gaccggccgc ccgcgtcgcc       240
     gccggcggcg acgtgctgcg gctcaccggc cgctgcgacc ggctcgacgt ccgcctcgtc       300
     gccagccgcg attggcgctg ggggagcgag tgtgccgtca gctaccgcgt gcgcgtgccg       360
     gtcgggctcg acgtgcgcgt ctctaccggc accggcgacg tgcggctggt cggcctggcc       420
     ggcgcgatcg acgcggaggc gcacgacggc gacgtgaccg cggtcgggct ccgttcgccg       480
     cacgtcacac tgcgggcgac cggcgccggg gcgatccgcg cacgatttgc ggctgtcccc       540
     ggtgcggtcg acgcacgtgc cgaaggcggt gcggtgcgac tcgcgctgcc cccgggtcgc       600
     taccacctga gcgccgacgc gccgcgcggg cgcacctgga tcggcgccgg gatcgacgcc       660
     gaccccgccg gccgcagcac cgtcggcgcg agcgccggcg acggcgacgt gacggtggag       720
     gcggcgcgat ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page