(data stored in ACNUC7421 zone)

EMBL: CP001854.PE261

CP001854.PE261       Location/Qualifiers
FT   CDS_pept        267626..268915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0261"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48697"
FT                   /db_xref="GOA:D3F624"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F624"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADB48697.1"
FT                   /translation="MSGAAGGAPGAVASEPRRAAAARAALGAVARAVAAPLSSARTWTA
FT                   AADLVLGAAAALLVAFVVAAAAERGLTAALVASALMLLLAAAVSGASGALDRRLANALL
FT                   DAGIEAPQPASARPSWRAYAWTLLRLPLALVALLALVLTVFVALLLVLAPFSGGLGDAP
FT                   LLAQAWCVLAGIALGLLALHGIDAWRWLHVRLARALLGRSGAQRLVALRERAERLAARA
FT                   ELARDLHDSVGHAVTAATLQAAAARRVLARDPQFAADALKAIEQQGRRALDELDHVLAS
FT                   LRDEDDGAARGARAAPRRPAPGLGDVDRLLERTRAAGVPLTVVQRGERDGIAPVLDREA
FT                   YRVLQEGLTNVLRHAAGATTRVLVEAASDQLAIVVDDDGGRALDPRRRGGGSGLRAAGE
FT                   RVRALGGTLEAGPVDGGGYRLRAMLPLRRR"
     atgagcggcg cggcgggcgg cgcgccgggc gccgtcgcga gcgagccgcg ccgcgccgcc        60
     gctgcgcgcg cagcgctcgg cgccgtcgcc cgagccgtcg ccgcgccgct gtcgagcgcg       120
     cgcacgtgga cggcggcggc cgacctggtg ctcggcgccg ctgcggctct gctcgtcgcg       180
     ttcgtcgtcg cggctgccgc ggagcgcggt ttgacggcgg cgctcgtcgc gagcgcgctc       240
     atgctgctgc tcgccgccgc cgtcagcggc gcgagcggcg cgctcgaccg gcggctcgcg       300
     aacgcgctgc tcgacgccgg gatcgaggcg ccgcagccgg cgagcgcgcg gccgagctgg       360
     cgcgcgtacg cgtggacgct gctccggctc ccgctcgcgc tcgtcgcgct gctggcgctg       420
     gtgctcaccg tgttcgtcgc gctgctgctc gtgctcgccc cgttcagcgg cgggctcggc       480
     gacgcgccgc tgctcgcgca ggcgtggtgc gtgctcgcgg ggatcgcgct cgggctgctg       540
     gcgctgcacg ggatcgacgc gtggcggtgg ctccacgtgc ggctcgcgcg ggcgctgctc       600
     ggccgctccg gcgcgcagcg gctcgtcgcg ctgagagagc gggccgagcg gctcgcggcg       660
     cgcgcggagc tggcgcgcga cctgcacgac tcggtcggtc acgcggtcac cgccgcgact       720
     ctgcaggctg ccgcggcgcg ccgggtcctc gcacgcgacc cgcagttcgc cgccgacgcg       780
     ctgaaggcga tcgagcagca gggacgccgt gcgctggacg agctcgacca cgtgctggcg       840
     agcctgcgcg acgaggacga cggcgccgcg cgcggagcgc gtgccgcgcc gcggcgcccg       900
     gcgcccggac tcggcgacgt cgatcggctg ttggagcgaa cgcgcgcggc cggcgtgccg       960
     ctcaccgtcg tgcagcgcgg cgagcgcgac ggcatcgccc cagtcctcga ccgcgaggcg      1020
     tatcgggtgc tgcaggaggg gctgacgaac gtgctgcgcc acgccgccgg tgcgacgacg      1080
     cgggtgctcg tcgaggccgc ctccgaccag ctcgcgatcg tggtcgacga cgacggcggc      1140
     agggcgctcg acccgcgccg gcgcggagga ggcagcggcc tgcgcgccgc gggcgagcgc      1200
     gtgcgcgcgc tcggcggcac gctcgaggcc ggcccggtcg acggcggcgg gtaccgtctg      1260
     cgcgcgatgc ttccgttgag aagacgatga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page