(data stored in ACNUC7421 zone)

EMBL: CP001854.PE262

CP001854.PE262       Location/Qualifiers
FT   CDS_pept        268912..269589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0262"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48698"
FT                   /db_xref="GOA:D3F625"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F625"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48698.1"
FT                   /translation="MTAADEREPIRLLIADDDGLVRGGLRTLLANEPGLAVVGEAADGF
FT                   AAVRAAQELDPDVVLMDVRMPRLDGIEATRRVVAGGRARVLVVTTFEHDDYVYEALRAG
FT                   ASGFVLKRAEPEELVQAVRIVAGGESLVFPQLTRALIARSVQPGAGDGGARLLTVLTER
FT                   EAEILRLVARGMSNADVADELVLAVHTVKTHVARILAKLAVRDRTQAVVVAYESGFVRP
FT                   GDA"
     atgaccgcgg cagacgagcg cgagccgatc cggctgctga tcgcggacga cgacgggctc        60
     gttcgcggcg ggctgcgaac gctgctggcg aacgagcccg gcctcgcggt cgtcggggag       120
     gcggccgacg ggttcgccgc cgtgcgcgcc gcgcaggagt tggacccgga cgtcgtcctg       180
     atggacgtgc ggatgccgcg gctcgacggg atcgaggcga cgcgacgtgt cgtagccgga       240
     ggccgtgcgc gcgtgctcgt cgtcacgacg ttcgagcacg acgactacgt ctacgaggcg       300
     ctgcgggccg gcgcgagcgg cttcgtgctc aagcgcgcgg agccggagga gctcgtgcag       360
     gccgtgcgga tcgtcgccgg cggcgagtcg ctcgtcttcc cgcagctgac gcgcgcgttg       420
     atcgcgcgca gcgtccagcc cggcgccggc gacggcggcg cgcggctgct caccgtgctg       480
     acggaacgcg aggcggagat cctgcgcctc gtcgcacgtg ggatgagcaa cgccgacgtc       540
     gcggacgagc tggtgctggc ggtccacacc gtcaagacgc acgtcgcgcg gatcctcgcc       600
     aagctggcgg tgcgtgaccg cacccaggcc gtcgtcgtcg cctacgagag cggcttcgtg       660
     cgtcccggcg acgcctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page