(data stored in ACNUC7421 zone)

EMBL: CP001854.PE263

CP001854.PE263       Location/Qualifiers
FT   CDS_pept        complement(269553..270311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_1192 antifreeze glycopeptide AFGP
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48699"
FT                   /db_xref="UniProtKB/TrEMBL:D3F626"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48699.1"
FT                   /translation="MPDAGRSEPTSTGPWGPDGRRAAVAIVFAGLAGTTPEHPVTPALP
FT                   TLLRVLGDRDLPATFCVEAPIAASEPFALSMVGVGAHELAALAPPSGSAAPALDALAQE
FT                   RFSAAGVLLPAGADADPSVPTSLRDELTRAGVSYLAAPAHAADETARLDGDLVRIPIAL
FT                   DDGDDPAPSAFHLRFQATVGSTLARGGLLVVALRPSCFERQDALDVLVESLDLLAGLRR
FT                   AERLWTPRLRELADALGADQASPGRTKPLS"
     atgcccgacg ccggccgatc cgagcccacc tccaccggcc cgtggggacc cgacggccgt        60
     cgcgcggccg tcgcgatcgt cttcgccggg ctcgccggca cgacccccga gcacccggtg       120
     acgcccgcgc tgccgacgct gctgcgggtg ctcggcgacc gcgacctgcc ggcgaccttc       180
     tgcgtcgagg cgccgatcgc cgcgagcgag ccgttcgcgc tctcgatggt cggcgtcggc       240
     gcgcacgaac tggccgcgct cgctccgccc tccggctccg cggcgcccgc gctcgacgcg       300
     ctcgcgcagg agcgcttcag cgcggctggc gtactgctcc cggccggcgc cgacgccgat       360
     ccgagcgtcc ccacctcgtt gcgggacgag ctgacgcgag ccggcgtcag ctacctggcc       420
     gcgcccgctc acgccgcaga cgagacggcg cggctcgacg gcgacctcgt ccgcatcccg       480
     atcgcgctcg acgacggcga cgaccccgcc ccgagcgcct tccacctgcg cttccaggcg       540
     acggtcggct cgacgctcgc gcgtggcggc ctgctcgtcg tcgcgctgcg ccccagctgc       600
     ttcgagcgcc aggacgcgct cgacgtgctc gtcgagagcc tcgacctgct cgccggcctg       660
     cgtcgcgcgg agcggctgtg gaccccgcgc ctgcgcgagc tggccgacgc gctcggcgcg       720
     gatcaggcgt cgccgggacg cacgaagccg ctctcgtag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page