(data stored in ACNUC7421 zone)

EMBL: CP001854.PE264

CP001854.PE264       Location/Qualifiers
FT   CDS_pept        270310..270942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0264"
FT                   /product="putative phospholipase/carboxylesterase family
FT                   protein"
FT                   /note="KEGG: bbt:BBta_7203 putative
FT                   phospholipase/carboxylesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48700"
FT                   /db_xref="GOA:D3F627"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F627"
FT                   /inference="similar to AA sequence:KEGG:BBta_7203"
FT                   /protein_id="ADB48700.1"
FT                   /translation="MICIVPDLAFDHHFEPGTAGDTLLLLHATGGDERQLVPLGRQLAP
FT                   GAALLAPRGQVLENGRVRRFFARRGPADLDLDDLRERTTGLAAFVGDTLAQRELDPARV
FT                   TALGYSNGANVAVELLFSHPGLLHAAALLRPVLAYEPEQPLTGLDRTSVLIAVGDADPY
FT                   GPSEQIERLTELLREGGADVEVAVQPAGHELTEGDFTAVGDWLARVR"
     atgatctgca tcgtgcccga tctcgcgttc gaccaccact tcgagcccgg caccgccggc        60
     gacacgctcc tgctgctgca cgcgaccggt ggcgacgagc ggcagctggt cccgctcggc       120
     cggcagctcg cgcccggcgc cgcactgctc gccccgcgcg gccaggtgct ggagaacggc       180
     cgcgtgcgcc gcttcttcgc ccgtcgcggc ccggccgacc tcgacctcga cgacctgcgc       240
     gagcgcacca cggggctcgc cgcgttcgtc ggagacacgc tcgcgcagcg cgagctggac       300
     cccgcgcgcg tcaccgcgct cggctactcc aacggcgcga acgtcgccgt cgagctgctc       360
     ttctcccacc ccggcctgct gcacgccgcc gcgctgctgc gccccgtcct cgcgtatgag       420
     cccgagcagc cgctgaccgg cctcgaccgg acgagcgtgc tgatcgccgt cggcgacgcc       480
     gacccgtacg gcccgtccga gcagatcgag cggctgacag agctgctgcg cgagggcggc       540
     gccgacgtcg aggtcgccgt ccagcccgcc ggtcacgagc tgaccgaggg cgacttcacc       600
     gccgtcggcg actggctcgc gcgggttcgc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page