(data stored in ACNUC7421 zone)

EMBL: CP001854.PE265

CP001854.PE265       Location/Qualifiers
FT   CDS_pept        complement(270939..272648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0265"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48701"
FT                   /db_xref="GOA:D3F628"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3F628"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADB48701.1"
FT                   /translation="MTDASSLNPQQRAAALERMANETFEVVVIGGGAVGAGAALDAVTR
FT                   GLSVALVEARDFASGTSSRSSKLIHGGLRYLEQLDFRLVREALRERSLLLNTLAPHLVK
FT                   PVPFLYPLRQRFFERPYVEAGMLLYDTMAGHDGVPRHRHFTRRGALRIAPGLKPDSLIG
FT                   AIQYYDGKVDDARCTMTVARTAAHYGAAVANNAPVVGFLREGERVTGVRVHDLATGRDV
FT                   EVRAQQVVNATGVWTDDVQHLVRERGKFRVRASKGIHVVVPRDRIQLDTGLILRTEKSV
FT                   LFVIPWGRHWIVGTTDTDWELSKAHPAASRTDIDYVLEHANAVLAQPLTHEDVEGVYAG
FT                   LRPLLSGESESTSKLSREHSVAVPVPGLVAVAGGKYTTYRVMGKDAIDAAARGLDRSVP
FT                   ESVTHRTELLGADGYRALWNGRHRLAKQSGLHPARIEHLLDRYGSCIHDLLALVAERPE
FT                   LAEPLPGADDYLAVEVHYAAASEGARHLDDVLARRTRISIETFHRGVETAPVAARLMGD
FT                   VLGWSRADVRREVDTYTARVEAERRSQEQPDDEAADEVRTAAPDLLAGVGDA"
     gtgaccgacg ccagcagcct caacccccag caacgcgccg ccgccctgga gcggatggcg        60
     aacgagacgt tcgaggtcgt cgtgatcggc ggcggcgccg tcggcgcggg ggcggcgctc       120
     gacgccgtca cgcgcgggct gtcggtcgcg ctggtcgagg cgcgcgactt cgcctccggc       180
     acgtcgagcc gctccagcaa gctgatccac ggcggcctgc gctacctcga gcagctcgac       240
     ttcagactcg tgcgcgaggc gctgagagag cgctcgctgc tgctcaacac gctcgccccg       300
     cacctcgtca agccggtccc gttcctctac ccgctgcggc agcgcttctt cgagcggccg       360
     tatgtcgagg ccgggatgct cctctacgac acgatggccg gccacgacgg cgtcccgcgc       420
     caccgccact tcaccagacg cggcgcgctg cggatcgcgc cggggctgaa gcccgactcg       480
     ctgatcggcg cgatccagta ctacgacggc aaggtcgacg acgcgcgctg cacgatgacg       540
     gtcgcgcgga ctgccgccca ctacggcgcg gcggtcgcga acaacgcgcc ggtcgtcggc       600
     ttcctgcgcg agggcgagcg cgtgaccggc gtgagagtgc acgacctcgc gaccggcaga       660
     gacgtcgagg tgcgcgcgca gcaggtcgtc aacgcgaccg gcgtgtggac cgacgacgtc       720
     cagcacctcg tgcgcgagcg cggcaagttc agggtgcgtg cgtcgaaggg gatccacgtc       780
     gtcgtcccgc gtgaccgcat ccagctcgac accgggctga tcctcagaac cgagaagagc       840
     gtcctgttcg tgatcccgtg gggacgccac tggatagtcg gcacgaccga caccgactgg       900
     gagctgagca aggctcaccc ggccgcgagc aggaccgaca tcgactacgt gctggagcac       960
     gccaacgccg tgctcgcgca gccgctgacg cacgaggacg tcgagggcgt ctacgccggt      1020
     ctgcggccac tgctgtcggg cgagtcggag tcgacctcga agctcagccg tgagcacagc      1080
     gtcgcggtgc cggtgccggg cctcgtggcc gtcgccggcg gcaagtacac gacgtaccgc      1140
     gtgatgggca aggacgcgat cgacgccgcc gcgcgcgggc tcgaccgcag cgtgcccgag      1200
     tctgtcaccc accgcaccga gctgctcggc gccgacggct accgggcgct gtggaacggc      1260
     cgccaccggc tcgcgaagca gagcgggctg catccggcgc ggatcgagca cctgctggac      1320
     cgctacggct cgtgcatcca cgacctgctc gcgctcgtcg ccgagcgccc ggagctggcc      1380
     gagccgctcc ccggcgccga cgactacctc gccgtcgagg tccactacgc cgccgcgagc      1440
     gagggcgccc gccacctcga cgacgtgctc gcgcgccgca cgcggatctc gatcgagacg      1500
     ttccaccgcg gcgtcgagac ggcgccggtc gcagcgagac tgatgggcga cgtgctcggc      1560
     tggagcagag cggacgtcag acgcgaggtc gacacgtaca ccgcgcgcgt cgaggccgag      1620
     cgccgctcgc aggagcaacc cgacgacgag gccgcggacg aggtccgcac cgccgcgccg      1680
     gacctgctcg ccggcgtcgg cgacgcctag                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page