(data stored in ACNUC7421 zone)

EMBL: CP001854.PE266

CP001854.PE266       Location/Qualifiers
FT   CDS_pept        complement(272695..273096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48702"
FT                   /db_xref="GOA:D3F629"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3F629"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48702.1"
FT                   /translation="MLFGDEHVKRYEETDGAEGHEWQGTTSLILTTRGRKSGEERKAAL
FT                   IYQRDGDDLLVVASRGGAPQPPAWFLNLEADPEVGVQVEGDRFTARARTATPEEKPGMW
FT                   RKMTAVWPDYDTYQTKTDREIPVVVLERV"
     atgctgttcg gcgatgagca cgtgaagcgc tacgaggaga ccgacggggc cgagggccac        60
     gagtggcagg ggacgacctc gctgatcctc acgacgaggg ggcggaagtc cggcgaggaa       120
     cgcaaggccg cgctgatcta ccagcgcgac ggagacgatc tgctggtcgt cgcctccaga       180
     ggcggcgcgc cgcagccgcc cgcgtggttc ctcaacctcg aagccgatcc cgaggtcggc       240
     gtgcaggtcg agggcgacag attcaccgcc cgcgcccgca ccgccacgcc cgaggagaag       300
     ccggggatgt ggcgcaagat gacggccgtc tggcccgact acgacacgta ccagacgaag       360
     accgaccgcg agatcccggt cgtggtgctg gagcgggtct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page