(data stored in ACNUC7421 zone)

EMBL: CP001854.PE267

CP001854.PE267       Location/Qualifiers
FT   CDS_pept        complement(273132..277070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0267"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: spe:Spro_2595 ATP-dependent RNA helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; protein of unknown
FT                   function DUF1605; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48703"
FT                   /db_xref="GOA:D3F630"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F630"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ADB48703.1"
FT                   /translation="MPSPSPPDAPLADLRARLTDLTLRDEHRIRRRFDRLRSTHGDDER
FT                   GAALMKIAADVEESEARVARRRASVPQVTYPPQLPVSARKDELLEAIRDNQVVVVAGET
FT                   GSGKTTQLPKICLELGRGVRGAIAHTQPRRLAARTVAERIAEELDVPLGDAVGYAVRFN
FT                   DKTSESTLVRLVTDGLLLAQIQRDPLLRRYDTIIVDEAHERSLNIDFLLGCIKRILPRR
FT                   PELKLIITSATIDPQRFSRHFGDAPIVEVSGRTYPVEVRYRPLAVEAPDGEEAPDDRDQ
FT                   IDAIGDAVQELRRESKGDVLVFLSGEREIRDTADALSGRFGDRLDVLPLYARLATAEQQ
FT                   RVFRPHSKQRVVLATNVAETSLTVPGIRYVVDPGSARISRYSARLKVQRLPIEAVSQAS
FT                   ADQRKGRCGRQSDGICIRLYSEQEFEARPRFTDPEILRTNLASVILQMAALGLGAIEEF
FT                   PFLEPPDRRQIRDGVLLLQELGALAEGELTPLGRKLAQLPVDPRLGRMVLEADRLDCAD
FT                   EAIVIAAALSIQDPRERPSEHQAQADQAHARFKDDDSDFTAFLSLWRYLREQQRAHNNS
FT                   QFRKRLKREFLHYLRVREWQDLAGQLREAARGVGVTLNQQPAEMAEVHRALLSGLLSHV
FT                   GMKETSARRRGEYLGARGARFMIFPGSGQARRQPAWVMAAELVETSRLWGRVVARIEPE
FT                   WVEALAEHLVRRTHSEPRWEKKRSEVVATERVTLYGLPIVGGRTVSYARIDPVLARELF
FT                   IRRALVEEDWHTRHHFFHDNRELIDQIEELEHRARRRDILVGDDVLFDFYDARIPADVV
FT                   SGAHFDRWWKQERQRDPRRLTFTLDLLADRDAAAGALDERARPESWTQGALRLPLTYHF
FT                   EPGAEHDGVTVHVPLPALAGLSEQGFEWLVPAFRLELITTLIRSLPKELRRPLVPVPDV
FT                   AAQVLAALTPEEPRSAQLLDTIARAIVRLRGVRVSPGDFDRGRLPAWLRMRFRIEEEDG
FT                   RLVAEGDDLEALRARVRPRLQAELTASAGSTLERSGLRSWTIGTLPRTVELPGTGGMAK
FT                   AYPALVDEGASVGVRVMDTPGEQWVAMHGGTRRLLLLSVPGATLKHVQGQLGATAALAL
FT                   ATAPHGSAAAVLDDAMNAAVDALMAEAGGPAWDAVGFARLRDHVAGNLVERTTAIVAQV
FT                   SRILALRGEIMERIATLAAPQYEAVRLDVARQAGRLVYPGFVAGTGVARLDDVERYLRG
FT                   AVHRLDRVPDHRAADADRMKAVHELEQAVQERRASWPPGRPFPPALFEVGWLLEELRMS
FT                   HFAQPLGVRGQVSSKRIRRALAEAWAAG"
     gtgccctcgc cgtccccgcc ggacgcgccg ctcgccgacc tgcgcgcgcg cctgacagat        60
     ctcacgctgc gtgacgagca ccgcatccgg cggcgcttcg accgcctgcg ctcgacgcac       120
     ggcgacgacg agcgtggcgc ggcgctgatg aagatcgccg ccgacgtgga ggagtccgag       180
     gcgcgcgtcg cgcggcggcg cgcgagcgtg ccgcaggtga cctacccgcc gcagctgccg       240
     gtcagcgcgc gcaaggacga gctgctggag gcgatccgtg acaaccaggt cgtcgtcgtc       300
     gcgggcgaga ccggctcggg caagacgacg cagctgccga agatctgcct cgagctgggc       360
     cgcggcgtgc gcggcgcgat cgcgcacacg cagccgcgcc ggctcgccgc gcggacggtg       420
     gcggagcgga tcgcggagga gctggacgtg ccgctcggcg acgcggtcgg ctacgccgtc       480
     cgcttcaacg acaagacgag cgagagcacg ctcgtgcggc tcgtgaccga cggcctgctg       540
     ctcgcgcaga tccagcgcga cccgctgctg cgccgctacg acacgatcat cgtcgacgag       600
     gcgcacgagc gcagcctcaa catcgacttc ctgctcggct gcatcaagcg gatcctgccg       660
     agacggccgg agctgaagct gatcatcacc tccgcgacga tcgacccgca gcgcttctcc       720
     agacacttcg gcgacgcgcc gatcgtcgag gtctcgggtc gcacctaccc ggtcgaggtg       780
     cgctaccgac cgctggcggt ggaggcgccc gacggcgagg aggcgcccga cgaccgcgac       840
     cagatcgacg cgatcggcga cgccgtccag gagctgcgcc gcgagagcaa gggcgacgtg       900
     ctcgtcttcc tcagcggcga gcgcgagatc cgcgacacgg ccgacgcgct gagcggccgc       960
     ttcggcgaca gactcgacgt gctgccgctg tacgcgcggc tcgcgaccgc cgagcagcag      1020
     cgcgtcttca gaccgcactc gaagcagcgc gtcgtgctcg cgacgaacgt cgccgagacg      1080
     tcgctgacgg tgccggggat cagatacgtc gtcgatccgg gcagcgcgcg gatcagccgc      1140
     tacagcgcgc ggctgaaggt ccagcggctg ccgatcgagg cggtctccca ggcgtccgcc      1200
     gaccagcgca agggccgctg cggccgccag tcggacggca tctgcatccg cctctactcg      1260
     gagcaggagt tcgaggcgcg gccgcgcttc accgaccccg agatcctgcg cacgaacctc      1320
     gccagcgtga tcctccagat ggcggcgctc gggctcggcg cgatcgagga gttcccgttc      1380
     ctcgagccgc cggacagacg ccagatccgc gacggcgtgc tgctgctgca ggagctgggc      1440
     gcgctcgccg agggcgagct gacgccactc ggccgcaagc tcgcgcagct gccggtcgac      1500
     ccgcggctgg ggcggatggt gctggaggcg gacaggctcg actgcgcgga cgaggcgatc      1560
     gtgatcgccg cggcgctgtc gatccaggac ccgcgcgagc ggccgagcga gcaccaggcg      1620
     caggcggacc aggcgcacgc ccgcttcaag gacgacgact ccgacttcac cgcgttcctg      1680
     agcctctgga gatatctgag ggagcagcag agagcgcaca acaactcgca gttccgcaag      1740
     cggctgaagc gggagttcct tcactacctg cgcgtgcgcg agtggcagga cctcgccggc      1800
     cagctgcgcg aggcggcgag aggcgtcggc gtgacgctca accagcagcc ggccgagatg      1860
     gccgaggtcc acagagcgct gctgagcggc ctgctctcgc acgtcgggat gaaggagacg      1920
     agcgcgagaa gacgcggcga gtacctcggc gcgcgcggcg ccagattcat gatcttcccc      1980
     ggctccggcc aggcccgcag acagccagcg tgggtgatgg ccgccgagct ggtcgagacg      2040
     tcgcggctgt gggggcgcgt cgtcgcaagg atcgagccgg agtgggtcga ggcgctcgcc      2100
     gagcacctcg tcagacgcac gcactccgag ccgcgctggg agaagaagcg ctctgaggtc      2160
     gtcgcgaccg agcgcgtcac gctctacggc ctgccgatcg tcggcgggcg cacggtctcc      2220
     tacgcgcgaa tcgaccccgt gctcgcgcgc gagctgttca tccgccgcgc gctcgtggag      2280
     gaggactggc acacgcgcca ccacttcttc cacgacaacc gcgagctgat cgaccagatc      2340
     gaggagctgg agcacagagc gcggcgccgc gacatcctcg tcggcgacga cgtgctgttc      2400
     gacttctacg acgcgcggat cccggccgac gtggtctccg gcgcgcactt cgacagatgg      2460
     tggaagcagg agcggcagcg cgatccgaga cggctgacgt tcacgctcga cctgctggcc      2520
     gacagagacg ccgccgccgg cgcgctcgac gagcgcgcgc ggccggagag ctggacgcag      2580
     ggggcgctga ggctgccgct cacctaccac ttcgagccgg gcgccgagca cgacggcgtg      2640
     accgtgcacg tgccgctgcc ggcgctcgcc gggctgagcg agcaaggctt cgagtggctc      2700
     gtcccggcgt tccggctgga actgatcacg acgctgatcc gctcgctgcc gaaggagctg      2760
     cgccggccgc tcgtgccggt gccggacgtc gcggcgcagg tgctcgccgc gctcacgccg      2820
     gaggagccgc gcagcgcgca gctgctcgac acgatcgcgc gcgcgatcgt caggctgcgc      2880
     ggcgtgcggg tgtcgccggg cgacttcgac cgcgggcgcc tgccggcgtg gctgagaatg      2940
     cgcttccgga tcgaggagga ggacggcagg ctcgtcgccg agggcgacga cctggaggcg      3000
     ctgcgggcgc gggtgcggcc acggctgcag gcagagctga ccgcgtcggc gggttcgacg      3060
     ctggagagaa gcggcctcag atcgtggacg atcggcacgc tgccgagaac ggtcgagctg      3120
     ccggggacgg gcgggatggc gaaggcgtac ccggcgctcg tcgacgaggg cgcgagcgtc      3180
     ggcgtgagag tgatggacac accgggcgag cagtgggtcg cgatgcacgg cggcacgcgc      3240
     cggttgctgc tgctgtcggt gcccggcgcg acgctgaagc acgtccaggg ccagctcggc      3300
     gcgaccgctg cgctggcgct cgcgaccgcg ccgcacggca gcgcggcggc cgtcctcgac      3360
     gacgcgatga acgccgccgt cgacgcgctg atggccgagg caggcggccc ggcgtgggat      3420
     gccgtgggct tcgcgcggct gcgcgaccac gtcgccggca acctcgtcga gcgcacgacc      3480
     gcgatcgtcg cgcaggtgtc gcggatcctc gcgctgcgcg gcgagatcat ggagcggatc      3540
     gccacgctcg ccgcgcccca gtacgaggcc gtgcggctcg acgtcgcgcg ccaggccggc      3600
     cggctcgtct accccggctt cgtcgccggc accggcgtcg cgcggctcga cgacgtcgag      3660
     cgctacctgc gcggcgccgt ccaccggctc gaccgcgtgc ccgaccaccg cgccgccgac      3720
     gccgaccgca tgaaggccgt ccacgagctg gagcaggccg tgcaggaacg gcgcgcgagc      3780
     tggccccccg gccgtccctt cccgcccgcg ctgttcgagg tcggctggct gctggaggag      3840
     ctgcgcatga gccatttcgc gcagccgctc ggcgtcagag gccaggtctc ctccaagcgc      3900
     atccgcagag cgctggcgga agcgtgggcg gcggggtaa                             3939
//

If you have problems or comments...

PBIL Back to PBIL home page