(data stored in ACNUC7421 zone)

EMBL: CP001854.PE268

CP001854.PE268       Location/Qualifiers
FT   CDS_pept        complement(277158..278000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0268"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bmn:BMA10247_2444 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48704"
FT                   /db_xref="GOA:D3F631"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3F631"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADB48704.1"
FT                   /translation="MTALLLSLGASLAWGVSDFGGGTAARRYSTITVLLFMRIGGVLAM
FT                   GALALATTAPWVGSHWPFAVAAVATTIGGGLAMLRALAIGPMGIAAPIVAASGAVPAIF
FT                   GLATGRAPSTVALAGLAVAAAGAVLASRAPGHRGERVAPAGVGFALLAALLIGSSLLLM
FT                   HEASAESAVSAVLLERSLEALCLVLFVVLRPRLLSPTDGAGRLPLLAIGALESCAIVSF
FT                   AAASTLGSLTSAAVLSSLYPVVTVLLARALHDERLSRAQLAGALLTLAGVVVVVATSA"
     atgaccgccc tgctcctctc cctcggcgcg tcgctcgcct ggggcgtgag cgacttcggc        60
     ggcgggaccg ccgcccgccg ctacagcacg atcaccgtgc tgctgttcat gcgcatcggc       120
     ggcgtgctcg cgatgggcgc gctcgcgctc gcgacgaccg cgccgtgggt cggctcgcac       180
     tggccgttcg cggtcgcggc agtcgccacc acgatcggcg gcgggctcgc gatgctgcgc       240
     gcgctggcga tcgggccgat ggggatcgcc gcgccgatcg tcgccgcgag cggcgcggtc       300
     cccgcgatct tcggcctcgc gaccggtcgc gcgccgagca ccgtcgcgct cgccgggctc       360
     gccgtcgccg ccgccggcgc ggtcctcgcg agccgcgcgc ccggccaccg cggcgagcgc       420
     gtcgccccgg ccggcgtcgg cttcgcgctg ctcgccgcgc tgctgatcgg ctcctcgctg       480
     ctgctgatgc acgaagcctc cgccgagtca gctgtctccg cagtcctgct ggagcggtcg       540
     ctcgaagcgc tctgcctcgt gctgttcgtc gtgctgcggc cgcggctgct gtcgccgacc       600
     gacggcgccg gacggctgcc gctgctcgcg atcggcgcgc tggagagctg cgcgatcgtc       660
     tccttcgcgg ccgcctcgac gctcggctcg ctgacgagcg ccgcggtcct ctcctcgctc       720
     tacccggtcg tgacggtgct gctcgcacgg gcgctgcacg acgagcgcct ctcgcgcgcg       780
     cagctggccg gcgcgctgct gacactggcg ggcgtcgtgg tcgtcgtcgc gacgagcgcc       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page