(data stored in ACNUC7421 zone)

EMBL: CP001854.PE269

CP001854.PE269       Location/Qualifiers
FT   CDS_pept        complement(278075..279091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0269"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_pAT_447 DtxR/iron regulated lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48705"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3F632"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADB48705.1"
FT                   /translation="MRSPLRLLLLPLLAAIAVALTACGSDDDAATTAGGSAAGGTGTSG
FT                   SAAGAFPVTIESRLGSAEIEAAPERVVALDFSSADAAIALGVELVGMARVDYAEGGIQP
FT                   WTKALLRGAEPELFSTADGYPVEQIAALRPDVLLAANPYRIADVYDELAQIAPVVTYET
FT                   AEGHDTWQRSTERIGQALGRTSAAQQLIEQTEQEVADARRAHPQFDGKTISLFNMVDRT
FT                   AWVISDAEDFSVRFLADLGMTLSPTVARLRSAEGRAQVSPERYDLLDADVVIATAFDPR
FT                   ELEGLEDHGVFGKLDAVRRSAYVALPLSPATSIAFPSAVSVRYALSEIVPQVDRAVG"
     atgcgctctc ccctccgcct cctgctgctg ccgctgctcg ccgcgatcgc cgtcgcgctg        60
     acggcctgcg gctccgacga cgatgccgcg acgaccgccg gcgggagcgc ggccggcggg       120
     accggcacga gcgggagcgc cgccggcgcg ttccccgtca cgatcgagag cagactcggc       180
     agcgccgaga tcgaggccgc gcccgagcgt gtcgtcgcgc tcgacttctc ctccgccgac       240
     gccgcgatcg cgctcggcgt cgagctggtc gggatggcga gagtcgacta cgccgagggc       300
     ggcatccagc cgtggacgaa ggcgctgctc agaggcgccg agccggagct gttctcgacc       360
     gcggacggct acccggtcga gcagatcgcg gcgctgcggc ccgacgtgct gctggccgcg       420
     aacccctacc ggatcgccga cgtctacgac gagctggcgc agatcgcgcc cgtcgtcacg       480
     tacgagaccg cggaggggca cgacacgtgg cagcgctcga ccgagcggat cgggcaggcg       540
     ctcggcagaa cgagcgcggc gcagcagctg atcgagcaga ccgagcagga ggtcgccgac       600
     gcccgcagag cgcacccgca gttcgacggc aagacgatct cgctcttcaa catggtcgac       660
     agaaccgcgt gggtgatctc cgacgcagag gacttctcgg tcagattcct cgccgacctc       720
     ggcatgacgc tctcgccgac ggtcgcgaga ctgagaagcg ccgagggccg cgcgcaggtg       780
     agccccgagc gctacgacct gctcgacgcc gacgtcgtga tcgcgaccgc gttcgacccc       840
     agagagctgg aaggcctcga ggaccacggc gtcttcggca agctcgacgc ggtcagacgc       900
     agcgcgtacg tcgcgctgcc gctgtcgccc gcgacgtcga tcgcgttccc ctccgccgtc       960
     agcgtcagat acgcgctgag cgagatcgtg ccgcaggtcg acagagcggt gggctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page