(data stored in ACNUC7421 zone)

EMBL: CP001854.PE270

CP001854.PE270       Location/Qualifiers
FT   CDS_pept        279177..280301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0270"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE1467 putative ABC transport ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48706"
FT                   /db_xref="GOA:D3F633"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F633"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48706.1"
FT                   /translation="MSETPAIRTTGLRKVYRRGGADVVALDGVDLTVPRGQVFGVLGTS
FT                   GAGKSTLIRTVNGLERATAGSVEVGGVELTRLRGAALREQRRKIGMVFQHFNLLTSRTA
FT                   AQNVALPLEIVGVDRRERRERAQRLLELVGLGDQADAYPAQLSGGQKQRVGIARALAAE
FT                   PSVLLSDEATSALDEQTAASVLALLRDLNERLGLTIVLVTHQLSVVKQMADAAVLLRDG
FT                   RAVDAGTLADAAARPTSPLGRVLLPALPDDASAADARRDAHAGSLGGAADGSAAADGRE
FT                   LLDLVVVGDAARGVVAPLDAAADEPVRAALRAADVRYDVLAAVYEPVGGRPVARLRLAL
FT                   AGTADARAGARRALAAAGANPQQPVAETVQEPVA"
     atgtccgaga cgcccgcgat cagaacgacc ggcctgcgca aggtctaccg tcgcggcggc        60
     gccgacgtgg tggcgctcga cggcgtcgac ctgacggttc cgcgcggcca ggtcttcggc       120
     gtgctcggca ccagcggggc gggcaagagc acgctgatcc gcaccgtcaa cggcttggag       180
     cgcgcgacgg ccggcagcgt cgaggtcggc ggcgtcgagc tgacgcggct gcgcggtgcc       240
     gccctgcgcg agcagcgccg caagatcggc atggtcttcc agcacttcaa cctgctgacc       300
     tcgcggaccg ccgcccagaa tgtcgcgctg ccactggaga tcgtcggcgt cgaccgccgc       360
     gagcggcgcg agcgcgcgca gcggctgctg gagctggtcg ggctcggcga ccaggcggac       420
     gcctatcccg cgcagctctc cggcgggcag aagcagcgcg tcgggatcgc tcgcgcgctc       480
     gccgccgagc cgtcggtgct gctgtccgac gaggcgacct ccgcgctcga cgagcagacc       540
     gcggcctcgg tcctcgcgct gctgcgcgac ctcaacgagc ggctcggcct gacgatcgtg       600
     ctcgtcaccc accagctgtc ggtcgtcaag cagatggccg acgcggcggt gctgctgcgc       660
     gacggccgtg cggtcgacgc cggcacgctc gccgacgccg ccgcacgccc gacctcgccg       720
     ctgggccgcg tgctgctgcc ggcgctgccc gacgacgcga gcgccgccga cgcacgccgc       780
     gacgcgcacg ccggctcgct cggcggcgcc gccgacgggt ccgccgccgc cgacggccgc       840
     gagctgctcg acctcgtcgt cgtcggcgac gcggcgcggg gcgtcgtcgc gccgctcgac       900
     gccgcggccg acgagccggt gcgcgccgcg ctgcgcgccg ccgacgtccg ctacgacgtg       960
     ctcgccgccg tctacgagcc ggtcggcggc cgcccggtcg cacggctgcg gctcgcgctc      1020
     gccggcacag ccgacgcgcg cgccggcgca cgccgcgcgc tcgcggccgc gggcgccaat      1080
     ccccagcagc cggtcgcgga gacggtgcag gagccggtcg cgtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page