(data stored in ACNUC7421 zone)

EMBL: CP001854.PE271

CP001854.PE271       Location/Qualifiers
FT   CDS_pept        280298..280951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0271"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpf:Rpic12D_0862
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48707"
FT                   /db_xref="GOA:D3F634"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F634"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48707.1"
FT                   /translation="MSDDLVPLIREATGETLQMVGVAMLFTIPLGLLLGALLLLTDRGG
FT                   ALRQPVVNWVLGFVVNVGRSVPFIILLIAVIPFTRLVVGTTIGTTAAIVPLTLATIPFF
FT                   ARIVETSLREVPGGLVEAAQAAGANGRQVVFKVLVPEALPSLVAGVTITTIGVLGYSAM
FT                   AGAVGGGGLGDVAIRYGYQRYETDVTIATVVVLVVLVAVIQFAGDRLARHLSHA"
     gtgagcgacg acctcgtccc cctgatccgc gaggcgaccg gcgagacgct gcagatggtc        60
     ggcgtcgcga tgctcttcac gatcccgctc ggcctcctgc tcggcgcgct gctgctgctg       120
     accgaccgcg gcggcgcgct gcgccagccg gtcgtcaact gggtgctcgg cttcgtcgtc       180
     aacgtcggcc gctcggtccc gttcatcatc ctgctgatcg cggtgatccc gttcacgcgg       240
     ctcgtcgtcg ggacgacgat cgggacgacc gcggcgatcg tgccgctgac gctcgcgacg       300
     atccccttct tcgcccgcat cgtcgagacg tcgctgcgcg aggttccggg cgggctcgtc       360
     gaggcggcgc aggcggccgg cgcgaacggc cgacaggtcg tcttcaaggt gctcgtgccg       420
     gaggcgctgc cgtccctggt ggccggcgtg acgatcacga cgatcggcgt gctcggctac       480
     tccgcgatgg ccggcgcggt cggcggtggc ggcctcggcg acgtcgcgat ccgctacggc       540
     taccagcgct acgagaccga cgtgacgatt gcgaccgtcg tcgtgctcgt cgtcctcgtc       600
     gcggtcatcc agttcgccgg cgaccggctc gcgcgccacc tctcccatgc ttga             654
//

If you have problems or comments...

PBIL Back to PBIL home page