(data stored in ACNUC7421 zone)

EMBL: CP001854.PE272

CP001854.PE272       Location/Qualifiers
FT   CDS_pept        280974..281840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0272"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: maq:Maqu_0253 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48708"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3F635"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADB48708.1"
FT                   /translation="MRRIVLLPLLLVLLAIGVAACGSDDDGDSTAAATAAGTAAANAGR
FT                   PSSEPLRVGATPVPHVEILQFVQDELAARAGLTLDIREFTDYVVPNTALDEGQLDANYF
FT                   QTPGYLEDQSRARGYDFVSVADVHIEPLGIYSSKVRSLDEIADGATVAVPNDPANEARA
FT                   LRLLDAEGVISLEDPDSETATPRDIAENPKDLEFEEVEAAQTPRALDDVDLAVINGNYA
FT                   LEARLSPAEDALALERAAGNPNVNLLVTTPDLESDPRIVELARLLRSPQVRRFIADRYR
FT                   GAVIPAE"
     atgcgacgca tcgtccttct gccgctcctg ctcgtgctgc tggcgatcgg cgtcgcggcg        60
     tgcggcagcg acgacgacgg ggacagcacc gccgcggcga ccgccgccgg cacggccgcg       120
     gccaacgccg ggagacccag ctcggagccg ctgcgcgtcg gcgcgacgcc cgtcccgcac       180
     gtcgagatcc tccagttcgt gcaggacgag ctggccgcga gagccggcct gacactcgac       240
     atcagagagt tcaccgacta cgtcgtgccg aacaccgcgc tcgacgaggg gcagctcgac       300
     gcgaactact tccagacgcc gggctatctg gaggaccagt cgagagcgcg cggctacgac       360
     ttcgtctccg tcgccgacgt gcacatcgag ccgctcggga tctacagcag caaggtcaga       420
     tcgctcgacg agatcgccga cggcgccacc gtggcggtgc cgaacgatcc cgccaacgaa       480
     gcgcgcgcgc tgcggttgct cgacgccgag ggggtgatct cgctggagga ccccgacagc       540
     gagacggcga cgccgcgcga catcgccgag aacccgaagg acctcgagtt cgaggaggtc       600
     gaggccgcgc agacgccgcg cgcgctcgac gacgtcgacc tcgcggtgat caacggcaac       660
     tacgcgctgg aggcgagact gtcgccggcc gaggacgcgc tcgcgctgga gagagcggcg       720
     ggcaatccga acgtcaacct gctcgtgacg acgccggacc tcgagagcga cccgcggatc       780
     gtcgagctgg cgagactgct gcgctcgccg caggtcagaa gattcatcgc ggacagatat       840
     agaggcgcgg tgatcccggc cgagtag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page