(data stored in ACNUC7421 zone)

EMBL: CP001854.PE273

CP001854.PE273       Location/Qualifiers
FT   CDS_pept        282076..283395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0273"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   scl:sce1210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48709"
FT                   /db_xref="GOA:D3F636"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F636"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADB48709.1"
FT                   /translation="MSIAAIRTPVAGALLSVVGEQLRVPLVGGGETRYANLDYGATAPA
FT                   LSAVAERITRVLPYYGSVHRGSGLPARVSTALYEQARGTVARFAGARPDDAVVFTRNTT
FT                   DALNLLASAVPAGAGDVVFLDSEHHANLLPWRRGPHRELAVAPTLEETLARLGDALAAA
FT                   PVALVAITGASNVTGELLPLERVVALAHGAGARVVVDAAQLAPHRRVDLARIGADYLAL
FT                   SGHKLYAPYGSGVLIGRSDWLDAAPPYLAGGGAVRDVTAEDVVWHDGPARHEAGTPNLL
FT                   GAVALAAACDALDELAPGALEAHEASLRELLLARLTRIPGVRVARIWSDSRDAIGTVAF
FT                   TVEGWEPAHVGAYLSAEHGVGVRDGRFCAHQLLARLGLGPARAGALRASFGVGTSVEDV
FT                   ERLADALERLVRDGSRWAYAPGPDGWAPVGDDRPLPELLA"
     atgtcgatcg cagccatccg cacccctgtc gccggcgcgc tcctgtccgt cgtcggcgag        60
     cagctgcgcg tgccgctcgt cggcggcggc gagacgcgct acgccaacct cgactacggc       120
     gccaccgcgc ccgccctctc cgcggtcgcc gagcgcatca cgcgggtgct gccgtactac       180
     ggcagcgtcc accgcggctc cgggctcccc gcccgcgtct cgaccgcgct ctacgagcag       240
     gcgcgcggca cggtcgcccg cttcgccggt gcgcgccccg acgacgccgt cgtcttcacg       300
     cgcaacacga ccgacgcgct caacctgctc gcgagcgctg tgccggccgg cgcgggcgac       360
     gtcgtcttcc tcgactccga gcaccacgcg aacctgctgc cgtggcggcg cgggccgcac       420
     cgcgagctgg cggtcgcgcc gacgctggag gagacgctgg cacggctcgg cgacgcgctc       480
     gccgcggcgc ccgtcgcact cgtcgcgatc accggcgcct cgaacgtgac gggcgagctg       540
     ctgccgctgg agcgggtcgt cgcgctcgcg cacggcgccg gcgcgcgcgt cgtcgtcgac       600
     gccgcgcagc tcgcgccgca ccgccgcgtc gacctcgcgc ggatcggcgc cgactatctc       660
     gcgctgtccg gccacaagct ctacgcgccg tacggctcgg gcgtgctgat cggccgctcc       720
     gactggctcg acgcggcccc gccgtacctc gccggcggcg gcgcggtgcg cgacgtgacg       780
     gccgaggacg tcgtctggca cgacggcccg gcgcggcacg aggccggcac gccgaacctg       840
     ctcggcgcgg tcgcgctcgc ggccgcctgc gacgcgctcg acgagctggc gcccggtgcg       900
     ctggaggcgc acgaggcgtc gctgcgcgag ctgctgctgg cacggctgac gcggatcccg       960
     ggcgtgcggg tcgcgcggat ctggtccgac agccgcgacg cgatcggcac cgtcgccttc      1020
     accgtcgagg ggtgggagcc ggcgcacgtc ggcgcgtacc tgtcagccga gcacggcgtc      1080
     ggcgtgcgcg acggacgctt ctgcgctcac cagctgctcg cccggctcgg gctcggtccc      1140
     gcccgcgccg gcgcgctgcg cgcgagcttc ggcgtcggca cgagcgtcga ggacgtcgag      1200
     cggctcgccg acgcgctgga gcggcttgtg cgcgacggca gccgctgggc gtacgcgccc      1260
     ggccccgacg gctgggcgcc ggtcggcgac gaccgtccgc tgcccgagct gctggcgtag      1320
//

If you have problems or comments...

PBIL Back to PBIL home page