(data stored in ACNUC7421 zone)

EMBL: CP001854.PE274

CP001854.PE274       Location/Qualifiers
FT   CDS_pept        complement(283465..284787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0274"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: ilo:IL0161 secreted subtilisin-like
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48710"
FT                   /db_xref="GOA:D3F637"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3F637"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADB48710.1"
FT                   /translation="MNGHRTSHRARRRTLALAAATGLLSVAAPAAAPATAAAAPPAVAG
FT                   QLLVGFERGVSKARQTQLLDTAGARIARRYDAVRGGRLVLVRARGGAALSAIRSRLSRA
FT                   GGVAYAEPDYVLAATQTRTPDDPLYSRQYALVDGPAGHDVDAPTAWARRTSCARVAILD
FT                   TGIDTDHPDLAANVYKSADKPNNGKDDDHNGYVDDTYGFDAAAGKGSGEDDDGHGTHVA
FT                   GIVAARTNDALGVAGTCWSAKLLAVKFMNSRGKGSTSNAIAGIQYAVRQGVKIVNCSFG
FT                   SSANSSSLKDAIGYAQDHGVLLVVAAGNDSENIDRQPSYPASYANSNILTVAASDDEDR
FT                   LASFSDYGATAVDVAAPGDDILSTYLGGGYKTLSGTSMAAPYVAGVAALLRKQEPDASY
FT                   ADLRYAIRGHADAVPALSGKVASGGRLNAAKALAAIPALVD"
     atgaacggcc accggaccag ccaccgggcg cggcgccgca cgctcgcgct ggcggcggcg        60
     accggcctgc tgagcgtcgc cgcgccggcc gccgcgcccg ccacagccgc cgccgcgccg       120
     cccgcggtcg cgggccagct gctcgtcggc ttcgagcgcg gcgtctcgaa ggcgcgccag       180
     acccagctgc tcgacacggc cggtgcgcgg atcgcgcgtc gctacgacgc cgtccgcggc       240
     ggccggctcg tgctcgtgcg ggcacgcggc ggcgccgcgc tgtcggcgat ccgctcgcgt       300
     ctgagccgcg ccggcggcgt cgcctacgcg gagccggact acgtcctcgc cgccacgcag       360
     acgcgcacgc cggacgaccc gctctactcg cgccagtacg cgctcgtcga cggtcccgcc       420
     ggccacgacg tcgacgcgcc gacggcgtgg gcgagacgca cgagctgcgc ccgcgtcgcg       480
     atcctcgaca ccggcatcga caccgaccac cccgacctcg ccgccaacgt ctacaagagc       540
     gccgacaagc cgaacaacgg caaggacgac gaccacaacg gctacgtcga cgacacgtac       600
     ggcttcgacg cggcggcagg caagggctcg ggcgaggacg acgacgggca cgggacgcac       660
     gtcgccggca tcgtcgccgc gcgcacgaac gacgcgctcg gcgtcgccgg cacgtgctgg       720
     tcggcgaagc tgctcgcggt caagttcatg aacagccgcg gcaagggctc gacctcgaac       780
     gcgatcgcgg ggatccagta cgcggtccgc cagggcgtca agatcgtcaa ctgctcgttc       840
     ggctccagcg cgaactcgtc gtcgctgaag gacgcgatcg gctacgcgca ggaccacggc       900
     gtgctgctcg tcgtcgccgc cggaaacgac agcgagaaca tcgacagaca gccgagctac       960
     ccggcgtcgt acgcgaactc gaacatcctg accgtcgccg cgagcgacga cgaggaccgg      1020
     ctcgcgtcgt tctccgacta cggcgcgacc gcggtcgacg tcgccgcgcc cggcgacgac      1080
     atcctctcga cctatctcgg cggcggctac aagacgctct ccggcacgtc gatggccgcg      1140
     ccgtacgtgg ccggcgtcgc ggcgttgctg cgcaagcaag agccggatgc gagctacgcc      1200
     gacctgcgct acgcgatccg cgggcacgcc gacgcggtgc cggcgctgag cgggaaggtc      1260
     gcgagcgggg gccgcctgaa cgccgccaag gcgctcgcgg cgatccccgc gctggtcgac      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page