(data stored in ACNUC7421 zone)

EMBL: CP001854.PE275

CP001854.PE275       Location/Qualifiers
FT   CDS_pept        complement(284857..286059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0275"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: scl:sce6437 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48711"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3F638"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB48711.1"
FT                   /translation="MKTIRTTLALAAGLTLLTGAAAGTAAAAPTQLSAIDLDAALDTAL
FT                   ADSGAPGATVAVLDRGELVWSGAAGLAVDPSAAPMRLGAASAPAAVAMRTDTLQPIASL
FT                   TKSYTAVVILRLAEQRKLRLDATIDDWLPAVPGARTVTVRQLLQHTAGYPDVEADPYVT
FT                   RITSTRRRYDPDHRWTRAELIRLTRAPAFTPGTSWSYSNTNYLLLGEIAERAARAPFAR
FT                   LLDRYVARPLKLRDTLIRRSALPLQRFAHGYYFTAKTRFDTWSAARSVPSDAFGPVWTD
FT                   GGIATTALDAARFSDGLYRAGALLRPRTLATMTHTPGARFRGHGLGTKRFAFGDGARWQ
FT                   GFIGAYGGYTSMAATNRDSGITIAVLSNQLGIDPVTAPAPAIWVRIGQALGAVPDRAAL
FT                   G"
     gtgaaaacca tccgcacgac gctcgcgctc gcagcaggcc tcactctcct caccggggcc        60
     gccgccggca ccgcggccgc cgcccccacg cagctctccg ccatcgatct cgacgccgcg       120
     ctcgacacgg cgctcgccga cagcggcgcc cccggcgcca ccgtcgccgt gctcgacagg       180
     ggcgagctcg tctggtccgg cgcggccggt ctcgcggtcg atccgagcgc cgcgccgatg       240
     cgcctcggcg cggccagcgc gccggccgcc gtcgcgatga gaaccgacac gctccagccg       300
     atcgcgagtc tgacgaagag ctacaccgcc gtcgtgatcc tgcggctcgc cgagcagcgc       360
     aagctcaggc tcgacgcgac gatcgacgac tggctcccgg ccgtgcccgg cgcgcgcacc       420
     gtcaccgtcc ggcagctgct gcagcacacc gccggctacc cggacgtcga ggccgacccg       480
     tacgtcacgc ggatcacgag cacccgccgc cgctacgacc ccgaccaccg ctggacgcgc       540
     gcggagctga tccggctgac gagagcgccg gcgttcacgc ccggcacgag ctggagctac       600
     tcgaacacga actacctgct gctcggcgag atcgccgagc gcgccgcgag agcgccgttc       660
     gcccgcctgc tcgaccgcta cgtcgcgcgt ccgctgaagc tgcgcgacac gctgatcagg       720
     cgcagcgcgc ttccgctgca gcgcttcgcg cacggctact acttcactgc gaagacgcgc       780
     ttcgacacct ggtcggccgc gagatcggtc cccagcgatg cgttcggccc ggtctggacc       840
     gacggcggga tcgcgacgac ggcgctcgac gccgcgcgct tctccgacgg cctctaccgc       900
     gccggcgcgc tgctgcgccc gcgcacgctg gcgacgatga cgcacacgcc gggcgcgcgc       960
     ttcagaggcc acggcctcgg cacgaagcgc ttcgcgttcg gcgacggcgc gcgctggcag      1020
     ggcttcatcg gcgcctacgg cggctacacg agcatggcgg cgacgaaccg cgacagcggc      1080
     atcacgatcg cggtgctctc caaccagctc gggatcgatc cggtcaccgc tccggccccg      1140
     gcgatctggg tgcggatcgg ccaggcgctc ggcgccgtgc ccgaccgcgc cgcgctcggg      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page