(data stored in ACNUC7421 zone)

EMBL: CP001854.PE276

CP001854.PE276       Location/Qualifiers
FT   CDS_pept        complement(286189..286842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48712"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3F639"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48712.1"
FT                   /translation="MGRHPARRSDDAHAPEARPASAIGAMARGASAFGSSVFGATAMGA
FT                   LAVGRAAIGRLAIRRATVTRLEIDELIVGRLQIDAGGAATREQVAAWLDAYERAWRTPG
FT                   TDVLADLFTDDATYSPGPFRETLSGRPAIAAFWEDGRDGADERFAMRSELLAVEGDVGV
FT                   VRVEVDYERPEPSSFRDLWVVAFAPDGRCRAFEEWPFAPGDRLSPGAPPAPSDA"
     atgggacgcc acccggcccg caggagcgac gacgcacacg cacccgaggc gcgcccggcc        60
     agcgcgatcg gcgcgatggc ccgcggcgcc agcgcgttcg gctcgtccgt cttcggcgcg       120
     accgcgatgg gcgcgctcgc ggtcggccgt gcggcgatcg gccggctcgc gatccggcgc       180
     gcgaccgtga cgcgactgga gatcgacgag ctgatcgtcg ggcggctgca gatcgacgcc       240
     ggcggcgcgg ctacgcgcga gcaggtcgcg gcctggctcg acgcctacga gcgcgcctgg       300
     cgcacccccg gaaccgacgt gctcgccgac ctcttcaccg acgacgcgac gtacagcccc       360
     ggcccgttca gagagacgtt gagcggacgg cccgcgatcg ccgccttctg ggaggacggt       420
     cgcgacgggg ccgacgagcg gttcgcgatg cgcagcgagc tgctcgccgt cgagggcgac       480
     gtcggcgtcg tgcgcgtcga ggtcgactac gagcggcccg aaccgagcag cttccgcgac       540
     ctgtgggtgg tcgcgttcgc gcccgacggc cgctgccgcg cgttcgagga atggccgttc       600
     gcgcccggcg accggctctc gccgggagcg ccgccggcgc cgtcggacgc gtag             654
//

If you have problems or comments...

PBIL Back to PBIL home page