(data stored in ACNUC7421 zone)

EMBL: CP001854.PE277

CP001854.PE277       Location/Qualifiers
FT   CDS_pept        286908..287597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0277"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: dol:Dole_2617 regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48713"
FT                   /db_xref="GOA:D3F640"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F640"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB48713.1"
FT                   /translation="MSTSDTPARRVSDVVHERLRQQILGGDLAVGAAVPSERVLADELG
FT                   VNRHAVREALKRLEQAGLVQISQGGPTRVRDWRESGGLEVLLDLVDHPGELPPEELVRA
FT                   VLELRACIGTDAARRCAARAPLAVREQAARLAAATAATAETDPEAAVASYEALWQAIVA
FT                   GAGNLAHRLALNSLLAALDSFPALAAALLPRDVDSLLLLGSALLSGDDAAAAAAARTLL
FT                   EADLSSA"
     gtgagcacga gcgacacgcc ggcccgccgc gtctccgacg tcgtgcacga gcgtctgcgg        60
     cagcagatcc tcggcggcga cctcgcggtc ggcgccgccg tcccgtccga gcgggtgctg       120
     gcggacgagc tgggcgtcaa ccgccatgcc gtccgcgagg cgctgaagcg gctcgagcag       180
     gcggggctcg tgcagatcag ccagggtggt ccgacacgcg tgcgcgattg gcgcgagagc       240
     ggtgggctgg aggtgctgct cgacctcgtc gaccaccccg gcgagctgcc gccggaggag       300
     ctggtccgcg ccgtgctgga gctgcgcgcc tgcatcggca ccgacgctgc gcgccgctgt       360
     gccgcccgcg cgccgctcgc ggtgcgcgag caggcggcgc ggctcgccgc cgcgaccgcc       420
     gcgaccgccg agacggatcc cgaggccgcg gtcgcctcct acgaggcgct gtggcaggcg       480
     atcgtcgccg gcgccggcaa cctcgcccac cgcctcgcgc tcaactcgct gctggccgcg       540
     ctcgacagct tcccggcgct cgcggccgcg ctgctcccgc gcgacgttga cagcctgctg       600
     ctgctcggca gcgcgctgct cagcggtgac gacgccgccg ctgccgccgc cgcgcgcacg       660
     ctgctcgaag cggacttgtc gagcgcctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page