(data stored in ACNUC7421 zone)

EMBL: CP001854.PE278

CP001854.PE278       Location/Qualifiers
FT   CDS_pept        complement(287608..288228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0278"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_C7464 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48714"
FT                   /db_xref="GOA:D3F641"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3F641"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48714.1"
FT                   /translation="MPCDDRHRNAPLGCRGEPVLAAVRAATLRELAECGYAALTIDNVA
FT                   RRAGVHKTTVYRRWHDREQLLLDALSDHVATEVPVPDTGDVERDLRELARGLVRWIASP
FT                   AGGGVLATMLSDAGRVPAIAEARRRFYRQRFEQAAPIVRRAIERRELPAGTDPAELLKA
FT                   LMAPIYLRLLVTGEPLDEEAADRAAEVALAAARAGALSNPPRT"
     gtgccatgcg acgatcggca ccgcaacgcc ccgctgggct gccgcggcga acccgtcctc        60
     gcggcggtgc gcgccgcgac gctccgcgag ctggccgagt gcggctatgc cgcgctcacg       120
     atcgacaacg tcgcacggcg cgcaggcgtc cacaagacga ccgtctaccg ccgctggcac       180
     gatcgcgagc aactgctgct cgacgcgctg tccgaccacg tcgcgaccga ggtgcccgtg       240
     ccggacacgg gcgacgtcga acgcgacctg cgcgagctgg cgcgtgggct cgtgcgctgg       300
     atcgccagcc cggccggcgg cggcgtgctc gcgacgatgc tctccgacgc cggccgcgtg       360
     ccggcgatcg ccgaggcgcg ccggcgcttc taccggcagc ggttcgagca ggcggcgccg       420
     atcgtccgcc gcgcgatcga gcgccgggag ctgcccgccg gcaccgatcc ggccgagctg       480
     ctgaaggcgc tgatggcgcc gatctacctg cgcctgctcg tcacgggcga gccgctcgac       540
     gaggaagcgg ccgatcgcgc ggccgaggtc gcgctcgccg ccgcgcgggc gggcgcgctg       600
     agcaacccgc cgcgtacgta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page