(data stored in ACNUC7421 zone)

EMBL: CP001854.PE279

CP001854.PE279       Location/Qualifiers
FT   CDS_pept        288290..289078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0279"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mca:MCA2122 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48715"
FT                   /db_xref="GOA:D3F642"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F642"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48715.1"
FT                   /translation="MAGAPALHIADLTKRYPTGTEALRGVSLDIAAGEFFGLLGRNGAG
FT                   KSTLIHCTTGLVRPTSGAIRVFGHDAVDDYEQARTAVGLAPQELNFDWFLTLEETLDYH
FT                   GGYFGMPRKERRARSAELLEAFSLSEKRRERAMTLSGGMKRRLILARALMHRPRLLILD
FT                   EPTAGVDVELRLELWRYVRRINAEGTTILLTTHYLEEAEELCDRIAFIDGGRIVAEGTS
FT                   ASLTAEYGVETLEDAYLELAGRRELARGRLDDVAAAEVAS"
     atggccggcg cccccgcgct gcacatcgcc gacctgacca agcgctaccc gaccgggacc        60
     gaggccctgc gcggcgtctc gctcgacatc gccgccggcg agttcttcgg gttgctcggt       120
     cgcaacggcg ccggcaagtc gacgctgatc cactgtacga cgggcctcgt ccggccgacg       180
     tccggcgcga tccgcgtctt cggtcacgac gcggtcgacg actacgagca ggcgcgcacc       240
     gccgtcggcc tggcgccgca ggagctgaac ttcgactggt tcctgacgct ggaggagacg       300
     ctcgactatc acggcggcta cttcggcatg ccgcgcaagg agcggcgtgc acgctccgcc       360
     gagctgctgg aggcgttctc gctgagcgag aagcggcggg agagagcgat gacgctgtcg       420
     ggcgggatga agcggcggct gatcctcgcg cgggcgctga tgcaccggcc gagactgttg       480
     atcctcgacg agccgacggc gggcgtcgac gtcgagctgc ggctggagct gtggcggtac       540
     gtgagaagga tcaacgcgga ggggacgacg atcctgctga cgacgcacta cctcgaagag       600
     gccgaggagc tgtgcgaccg gatcgccttc atcgacggcg gccggatcgt cgcggaggga       660
     acgagcgcat cgctcaccgc cgagtacggc gtcgagacgc tggaggacgc ctacctggag       720
     ctggccggcc gcagagagct ggcgcgcggg cgcctcgacg acgtcgccgc ggctgaggtc       780
     gcatcgtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page