(data stored in ACNUC7421 zone)

EMBL: CP001854.PE280

CP001854.PE280       Location/Qualifiers
FT   CDS_pept        289075..289845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0280"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: vha:VIBHAR_03454
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48716"
FT                   /db_xref="GOA:D3F643"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3F643"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB48716.1"
FT                   /translation="MSAAQIRFLTLLRREVNRFMKIKKQTLGAPLLETFLYVSVFGAAL
FT                   GASIDRQPGGVRYVVFIVPGLIMMGLAINAFANNSSSILQQKFQRAIDDQLSSPASPLE
FT                   LLLALSLGGFLRGMIVAALTFVAAWLLVDLPVEHVLVLVPSLALVGFFFAQLGVLIGVR
FT                   AEQFDDVSFPQTFILQPLVFLGGVFYTVSVLPEPFETLTHFNPVYYMVGLIRYGFIGYS
FT                   EINVALSLALLTVATVALFAFNLRLFARGYKLRG"
     gtgagcgccg cgcagatccg cttcctcacg ctgctgcggc gcgaggtcaa ccgcttcatg        60
     aagatcaaga agcagacgct cggcgcgccg ctgctggaga cgttcctcta cgtctcggtc       120
     ttcggtgccg cgctcggcgc cagcatcgac aggcagccgg gcggggtcag atacgtcgtc       180
     ttcatcgtgc cgggcctgat catgatgggg ctggcgatca acgcgttcgc gaacaactcc       240
     tcctcgatcc tgcagcagaa gttccagcgc gcgatcgacg accagctctc ctcgcccgca       300
     tcgccgctgg agctgctgct ggcgctgtcg ctcggcggct tcctgcgcgg gatgatcgtc       360
     gcggcgctga cgttcgtcgc cgcctggctg ctggtcgacc tgccggtcga gcacgtgctg       420
     gtgctggtgc cgtcgctggc gctcgtcggc ttcttcttcg cgcagcttgg cgtgctgatc       480
     ggcgtgcgcg ccgagcagtt cgacgacgtc tcgttcccgc agacgttcat cctccagccg       540
     ctcgtcttcc tcggcggcgt cttctacacc gtctcggtcc tgccggagcc gttcgagacg       600
     ctgacccact tcaaccccgt ctactacatg gtcgggctga tccgctacgg cttcatcggc       660
     tactcggaga tcaacgtcgc gctctcgctc gcgctgctga cggtcgcgac ggtcgccttg       720
     ttcgcgttca acctccgcct gttcgcgcgg gggtacaagc tgcgcggctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page