(data stored in ACNUC7421 zone)

EMBL: CP001854.PE281

CP001854.PE281       Location/Qualifiers
FT   CDS_pept        290053..290997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0281"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: mxa:MXAN_6907
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48717"
FT                   /db_xref="GOA:D3F644"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D3F644"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADB48717.1"
FT                   /translation="MLEVFLAAIPFFLLSIALEAFVLAHHAREDRAGGAGGGGGGMLGY
FT                   ERRDTRTSLAMGAGHLVVLGAWKIVVLAVFAALYSLSPLRVPTDAWWGWVLLFFADDVA
FT                   FYLHHRAHHRIRLFWAQHVVHHSSERYNLSTALRQDWTPFSTGIFWLWMPLAGFAPWTI
FT                   FLAQSWSLLCQFGLHTETIRTLPRPIEWIFNTPSHHRVHHGSQQQYLDRNYGGILIVWD
FT                   RLFGTFEPERERVRYGLTRNIDTFNPVRVAFHEYAAIWHDVRTATSWRARLGYAFRGPG
FT                   WRPASRELSTEQERAVLDRCPPATPIQDDALTR"
     gtgctcgaag tcttcctcgc tgcaattccg ttcttcctgc tgtcgatcgc attggaggcg        60
     ttcgtgctcg cgcaccacgc gcgcgaggac cgagcgggtg gcgccggcgg gggcggcggt       120
     gggatgctcg gctacgagcg gcgcgacacg cgcacgagcc tcgcgatggg cgccggccac       180
     ctcgtcgtgc tcggcgcctg gaagatcgtc gtgctcgcgg tcttcgccgc gctctacagc       240
     ctctctccgc tgcgcgtgcc gaccgatgcg tggtggggct gggtgctgct cttcttcgcc       300
     gacgacgtcg ccttctacct ccaccatcgc gcccaccacc ggatccgcct cttctgggca       360
     cagcacgtcg tccaccacag ctctgagcgg tacaacctct cgacggcgct gcggcaggac       420
     tggacgccgt tctcgaccgg catcttctgg ctctggatgc cgctcgccgg attcgcgccg       480
     tggacgatct tcctcgcgca gtcgtggagc ctgctctgcc agttcggcct ccacaccgag       540
     acgatccgga cgctgccgcg cccgatcgag tggatcttca acacgccgag ccatcatcgc       600
     gtccaccacg gctcccagca gcagtacctc gaccgcaact acggcgggat cctgatcgtc       660
     tgggaccggc tgttcggcac cttcgagccc gaacgcgaac gcgtccgcta cgggctgacg       720
     agaaacatcg acacgttcaa cccggtgcgc gtcgcgttcc acgagtacgc cgcgatctgg       780
     cacgacgtgc gcaccgcgac gagctggcgc gcgcggctcg gctacgcctt ccgcggcccc       840
     ggctggagac ccgcgtcgcg tgagctgagc accgagcagg agcgggccgt cctggatcgc       900
     tgtcctcctg cgacaccaat ccaggacgac gccctcaccc gctag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page