(data stored in ACNUC7421 zone)

EMBL: CP001854.PE282

CP001854.PE282       Location/Qualifiers
FT   CDS_pept        complement(290994..291878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48718"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D3F645"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48718.1"
FT                   /translation="MIDLANAETFMATHARLLDRRRLAVLLGQEEPAGLLAALSAYRNP
FT                   DGGFGWALEADLRSPSSQPAGALHAFEVLEEAAPATSPMGAALCDWLATATLPGGGLPF
FT                   SVAGAAGPGTARWWAGADPGVPSLHITAAVAGHALRAAAHDPTVAAHPWLAQVTDWTLE
FT                   RIAAQEQPGHAYELKYTLQFLDAALGARPEAEGLMERTAAFVPASGELAVAGGVEGEKL
FT                   RSLEIAPLPDRPLRRLMPAAAIARQLDELEARQQPDGGWTVDFPSSSVAAALEWRGVAT
FT                   VLALITLRANQRA"
     atgatcgacc tcgcgaacgc agagaccttc atggccaccc atgcgcgcct gctcgaccgg        60
     cgccgcctcg ccgtcctgct cggacaggag gagccggccg ggctgctggc cgcgctgtcg       120
     gcctaccgca accccgacgg cggcttcggc tgggcgctcg aagccgacct gcgcagcccg       180
     agcagccagc cggcgggcgc gctgcatgcg ttcgaggtgc tggaggaggc cgcgccggcg       240
     acgagcccga tgggcgcggc gctgtgcgac tggctggcga ccgcgacgct gcctggcggc       300
     ggtctgccgt tctcggtcgc gggcgccgcc ggacccggca ccgcgcgctg gtgggccggc       360
     gccgaccccg gcgtcccgtc gctccacatc acggccgcgg tcgccggcca cgcgctccgc       420
     gccgccgcgc acgatcccac cgtcgccgcc cacccgtggc tcgcgcaggt gaccgactgg       480
     acgctggagc ggatcgccgc gcaggagcag cccggtcacg cctacgagct gaagtacacg       540
     ctccagttcc tcgacgcggc gctcggcgcg cggccggagg ccgaggggct gatggagcgc       600
     acggcggcgt tcgtcccggc gtccggcgag ctggcggttg caggtggcgt cgagggcgag       660
     aagctgcgct cgctcgagat cgccccgctg cccgaccgcc cgctgcggcg gctgatgccg       720
     gccgcggcga tcgcccgtca gctcgacgag ctggaggcgc ggcagcagcc cgacggcggc       780
     tggaccgtcg acttcccctc ctcgtcggtt gccgccgcgc tggagtggcg cggcgtcgcg       840
     acggtgctcg cgctcatcac cctccgagca aaccagcgcg cctag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page