(data stored in ACNUC7421 zone)

EMBL: CP001854.PE283

CP001854.PE283       Location/Qualifiers
FT   CDS_pept        291984..292442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0283"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mlo:mlr0267 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48719"
FT                   /db_xref="GOA:D3F646"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D3F646"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ADB48719.1"
FT                   /translation="MTTLYDYAGGRDAIVRLAEIHYGRCLTDPVLSQVFGTQGSATHAG
FT                   HLADWLTEVFGGPKLYTERHGGHEALLRHHANRSIAEPQRARFVAVFLESCDAAGLPAE
FT                   PRFRERLREYLEWGTAIALDVSQPGADVTSDDPVPVWDWGPAGPPPRA"
     atgacgacgt tgtacgacta cgccggcggc cgggacgcga tcgtgcgact cgccgagatc        60
     cactacggcc gctgcctgac cgacccagtc ctgtcgcagg tgttcgggac ccagggttcc       120
     gcgacgcacg caggacacct cgccgactgg ctgaccgagg tcttcggcgg ccccaagctc       180
     tacaccgagc gccacggcgg ccacgaggcg ctgctgcgcc accacgccaa ccgctcgatt       240
     gccgagccgc agcgggcgcg cttcgtcgcg gtcttcctcg aatcgtgcga tgcggctggc       300
     ctgccggccg agccgcgctt ccgcgagcgc ctgcgcgagt acctcgagtg gggcaccgcg       360
     atcgcgctcg acgtctctca gcccggggcc gacgtcacga gcgacgatcc ggtccccgtc       420
     tgggactggg gtcccgcggg gccgccgccg cgcgcgtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page