(data stored in ACNUC7421 zone)

EMBL: CP001854.PE284

CP001854.PE284       Location/Qualifiers
FT   CDS_pept        complement(292378..293376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0284"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; protein of unknown function
FT                   UPF0074; KEGG: scl:sce5223 DeoR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48720"
FT                   /db_xref="GOA:D3F647"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F647"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB48720.1"
FT                   /translation="MLETSGRLLRLLSLLQTRREWSGTDLAERLDVTTRTVRRDVDKLR
FT                   ELGYPVDATRGVAGGYRLGAGAELPPLLLDDEEAIAVAVGLRTATNGTVAGIEESSVRA
FT                   LAKLEQVLPNRLRRRVAALGAFTAALPNPGAAVDHELLSLIASAARDGERLRFAYRRYD
FT                   GTSARRLVEPSRLVHADRRWYLVAWDVERDDWRTFRVDRIDGTPMRDRRFEPREPPEED
FT                   VAAYVERNVVRARGRKEGRVLLHIPREEAARQVPQLTAALTAVDDDTCLLTTADDWWGG
FT                   LAVYVASMRCEFEVLDPPEFVAEVERLAEAFTRAAAAPRDPSPRRGPDRRS"
     atgctcgaaa cgtccggacg actgctccgc ctcctctcgc tgctgcagac gcggcgcgag        60
     tggtcgggca ccgacctcgc cgagcggctc gacgtgacga ctcgcaccgt ccggcgcgac       120
     gtcgacaagc tgcgcgagct gggctacccg gtcgacgcga cgcgcggcgt cgcgggcggc       180
     taccggctcg gcgcgggcgc cgagctgccg ccgctgctgc tcgacgacga ggaggcgatc       240
     gccgtcgcgg tcggcctgcg gaccgcgacg aacggcaccg tcgccggaat cgaggagagc       300
     tccgtgcgcg cgctcgcgaa gctggagcag gtgctgccga accgcctgcg gcggcgcgtc       360
     gccgcgctcg gcgcgttcac cgccgcgctg ccgaacccgg gcgccgcggt cgatcacgag       420
     ctgctcagcc tgatcgcgag cgcggcgcgc gacggcgagc gactgcgctt cgcctaccgg       480
     cgctacgacg ggacgagcgc acggcggctg gtcgagccga gccggctcgt ccacgccgac       540
     cgccgctggt acctcgtcgc ctgggacgtc gagcgcgacg actggcgcac cttccgcgtc       600
     gaccggatcg acgggacgcc gatgcgcgac cgtcgcttcg agccgcgcga gccgccggag       660
     gaggacgtcg cggcgtacgt cgagcgcaac gtcgtgcgcg cccgcgggcg caaggagggg       720
     cgcgtgctgc tgcacatccc gcgcgaggag gccgcgcgcc aggtgccgca gctgaccgcc       780
     gcgctgaccg cggtcgacga cgacacctgc ctgctgacca cggcggacga ctggtggggc       840
     ggcctcgcgg tctacgtcgc gtcgatgcgc tgcgagttcg aggtgctcga cccgccggag       900
     ttcgtcgccg aggtcgagcg gctggccgag gcgttcacgc gcgcggcggc ggccccgcgg       960
     gaccccagtc ccagacgggg accggatcgt cgctcgtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page