(data stored in ACNUC7421 zone)

EMBL: CP001854.PE285

CP001854.PE285       Location/Qualifiers
FT   CDS_pept        293439..294593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0285"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; KEGG:
FT                   reh:H16_A1793 epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48721"
FT                   /db_xref="GOA:D3F648"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F648"
FT                   /inference="protein motif:PFAM:PF06441"
FT                   /protein_id="ADB48721.1"
FT                   /translation="MTNSTAASTAVRPFTIDVPQADLDDLRDRLARTRWVDELPGAGTD
FT                   YGMPLATVRALADHWQDSFDWRAQEAKLNELPHFVTEIDGEQIHFLHIRSPHADALPLV
FT                   MTHGWPKTFTELLALVGPLTDPVAHGGEAKDAFHVVIPSPPGYAFSGPTRSKGWNYPRI
FT                   ARAWDTLMKRLGYARYGAQGGDLGSLVGLALGRLAPEGLIGTHVMQIFAFPSGDPAELE
FT                   KLDEHDRAGERIGEDFMAKAGYHAMSSSRPNTIGTALNDSPAGTLAWLLELPTNWGETP
FT                   LDQLDKDALLTDVTIYWVTRTVASAARIYYEDAHSGEDWDANNPTPTGVAVFPWDFQSV
FT                   RAFAERANTNIVHWKRMEYGSHFAAIDAPELLVADLREFYGGLR"
     atgacgaact ccaccgccgc ttccaccgcc gtccgcccct tcacgatcga cgtgccgcag        60
     gccgatctgg acgacctgcg cgatcgtctc gcccgcaccc gctgggtcga cgagctgccc       120
     ggtgcgggca ccgactacgg gatgccgctg gcgaccgtcc gcgcgctcgc cgaccactgg       180
     caggacagct tcgactggcg cgcgcaggag gcgaagctga acgagctgcc gcatttcgtg       240
     accgagatcg acggcgagca gatccacttc ctccacatcc gctcgccgca tgcggacgcg       300
     ctgccgctcg tgatgacgca cggctggccg aagacgttca ccgagctgct ggcgctggtc       360
     ggcccgctga ccgatccggt cgcgcacggg ggcgaggcga aggacgcctt ccacgtcgtg       420
     atcccgtcgc cgcccggcta cgccttctcc ggtccgacgc gctcgaaggg gtggaactac       480
     ccgcggatcg cgcgcgcctg ggacacgctg atgaagcggc tcggctacgc gcgctacggc       540
     gcgcagggcg gcgacctcgg ctcgctcgtc gggctcgcgc tcgggcgcct cgcgccggag       600
     ggcctgatcg gcacgcacgt gatgcagatc ttcgcgttcc cgtccggcga cccggcagag       660
     ctggagaagc tcgacgagca cgacagagcg ggcgagagaa tcggcgagga cttcatggcc       720
     aaggccggct accacgcgat gtcgtcgagc cgtccgaaca cgatcggcac cgcgctcaac       780
     gactcgccgg ccggcacgct cgcctggctg ctggagctgc cgacgaactg gggtgagacg       840
     ccgctcgacc agctcgacaa ggacgcgctg ctgaccgacg tgacgatcta ctgggtcacg       900
     cggaccgtcg cctcggccgc gcggatctac tacgaggacg cgcacagcgg cgaggactgg       960
     gacgcgaaca acccgacccc gactggcgtc gccgtcttcc cgtgggactt ccagtcggtg      1020
     cgcgcgttcg ccgagcgggc gaacacgaac atcgtccact ggaagcggat ggagtacggc      1080
     agccacttcg ccgcgatcga cgcgccggag ctgctcgtcg ccgacctgcg cgagttctac      1140
     ggcggattgc ggtag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page