(data stored in ACNUC7421 zone)

EMBL: CP001854.PE286

CP001854.PE286       Location/Qualifiers
FT   CDS_pept        294606..295733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48722"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D3F649"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3510"
FT                   /protein_id="ADB48722.1"
FT                   /translation="MPRVRTITDRELTLSLLARQLLLERRRLPAAEAVRRLVALQAQYS
FT                   PSPYIALHARVEGFAIADLERALRRGTVVKSTLMRGTLHLVHAAAYPAYASAWRFQARR
FT                   MLAPRERALDGGAPALVAALADFLREPRTTDEIRALVRELTDGRLSDGSEGLDFARGSL
FT                   PLVHVPPSGLWRQHGKFSLVRWETSGRGRAAVPEDPAAGTVALVRDYLAAFGPSTREDL
FT                   AAFTWLRFHQLDPALSALEPLRRLTDARGRELLDLPRAPLPREDVATPVRFLAKWDAAI
FT                   ISHRDRTRIVPPGFAQQVYAARNGEVAPTFLVDGQVAGTWRDREEDGEAVLEARSLIGG
FT                   SGSLPPDFEQEAERLLALLHPAARRRRVELVRDAA"
     atgccacgcg tgcggacgat caccgaccgg gagctgacgc tgtcactgct cgcccggcag        60
     ctgctgctgg agcggcggcg gctgccggcc gcggaggcgg tgcgccgcct cgtcgcgctg       120
     caggcgcagt actcgccgtc gccgtacatc gcgctgcacg cgcgcgtcga ggggttcgcg       180
     atcgccgacc tggagcgcgc gctgcgccgc ggcacggtcg tcaagtcgac gctgatgcgc       240
     ggcacgctcc acctcgtgca cgcggccgct tacccggcgt acgcgtcggc gtggcgcttc       300
     caggcacgtc ggatgctggc gccgagagaa cgggcgctcg acggcggcgc gccggcgctc       360
     gtcgcggcgc tcgcggactt cctgcgcgag ccgcgcacga ccgacgagat ccgcgcgctg       420
     gtacgcgagc tgacggacgg gcggctgtcg gacgggagcg agggcctcga cttcgcgcgc       480
     ggctcgctgc cgctcgtgca cgtgccgccg tcgggcctct ggcgtcagca cggcaagttc       540
     tcgctcgtgc gctgggagac gtcggggcgt gggcgcgcgg cggtgccgga ggatccggct       600
     gccgggacgg tcgcgctggt gcgcgactac ctcgcggcgt tcggcccgtc gacgcgcgag       660
     gatctcgccg cgttcacgtg gctgcgcttc caccagctcg atcccgcgct gtccgcactg       720
     gagccgctgc ggcggctcac cgacgcgcgc gggcgtgagc tgctcgacct gccgcgcgcg       780
     ccgctgccgc gcgaggacgt cgcgacgccg gtccgctttc tcgcgaagtg ggacgcggcg       840
     atcatctccc accgcgaccg cacgcggatc gtgccgcccg gcttcgcgca gcaggtgtac       900
     gccgccagaa acggcgaggt cgcgccgacg ttcctcgtcg acggccaggt cgcggggacg       960
     tggcgggacc gcgaggaaga cggcgaggcg gtcctcgagg cccgttcgct gatcggcggc      1020
     agcggctcgc tgccgccgga cttcgagcag gaggccgagc gcctgctcgc gctgctgcac      1080
     ccggccgcgc ggcggcgccg cgtcgagctg gtgcgcgacg ccgcctag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page