(data stored in ACNUC7421 zone)

EMBL: CP001854.PE29

CP001854.PE29        Location/Qualifiers
FT   CDS_pept        complement(30457..31269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0029"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 4 domain protein; sigma-70 region 2 domain
FT                   protein; Sigma-70 region 4 type 2; KEGG: dar:Daro_0743
FT                   sigma-70 region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48465"
FT                   /db_xref="GOA:D3F3Y2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y2"
FT                   /inference="protein motif:TFAM:TIGR02479"
FT                   /protein_id="ADB48465.1"
FT                   /translation="MKLDTRRHNRISAEDALALWRQYKESGDRAVRDRLVLTFAPMVKY
FT                   IVYKKVREIPARCEVEDFISCGLEALIHSIERYDPEKGATLEQFSWTRIHGAVLDELRR
FT                   QDWAPRSLRRWERDINQAREHFIGVHSRRPSREELAGALGTTPAELRAREDEIVASDVT
FT                   SLNTLVLSDDETAIERIDTLVSEDRFADPEHHTARDQAKMRFREAFERLPRREREVAVL
FT                   LYVKNLTLREIGGILGVSESRVCQIHGQLKRMLKEELIADSVLFSEVA"
     atgaagctcg acacgaggcg tcacaaccgc atctccgcag aagatgcgtt ggcgctctgg        60
     cggcagtaca aggagagcgg cgaccgcgcg gtgcgcgacc ggctcgtgct caccttcgcc       120
     ccgatggtca agtacatcgt ctacaagaag gtccgcgaga tccccgcgcg ctgcgaggtc       180
     gaggacttca tctcctgtgg gctggaggcg ctgatccact cgatcgagcg ctacgacccg       240
     gaaaagggcg cgacgctgga gcagttctcc tggacgcgca tccacggcgc cgtgctcgac       300
     gagctgcgcc gccaggactg ggccccgcgc tcgctgcgcc gctgggagcg ggacatcaac       360
     caggcccgcg agcacttcat cggcgtccac agccggcggc cctctcgtga ggagctggca       420
     ggggcgcttg gcacgacgcc agccgagctg cgtgcccgcg aggacgagat cgtcgcctcc       480
     gacgtcacct cgctcaacac gctcgtgctc agcgacgacg agacggcgat cgagcggatc       540
     gacacgctcg tcagcgagga ccgcttcgcc gatcccgagc accacaccgc gcgcgaccag       600
     gcgaagatgc gcttccgcga ggcgttcgag cggcttcccc gccgcgagcg cgaggtcgcg       660
     gtcctgctct acgtcaagaa cctgacgctg cgtgagatcg gcggcatcct cggcgtctcc       720
     gagagccgcg tctgccagat ccacggccag ctcaagcgga tgctgaagga agagctgatc       780
     gccgactccg tcctcttcag cgaggtcgcg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page