(data stored in ACNUC7421 zone)

EMBL: CP001854.PE3

CP001854.PE3         Location/Qualifiers
FT   CDS_pept        2691..3803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mxa:MXAN_0246 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48439"
FT                   /db_xref="GOA:D3EYQ6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADB48439.1"
FT                   /translation="MRIVRLALRNFRSYPTAEVELGAGLTVVSGRNGAGKTNLLDALYF
FT                   GCTGRSARTTNDRELVRFGEQVTRVVVMTEADDGAHELSVAFESGQPKRLMADGVRVER
FT                   LLDVPGRPLVSVFLPDRLELVKGTPSLRRAHIDQVVAALWPARAATRRAYAQALAQRNA
FT                   LVARIRAGGASAASLPAWDRELARHGVALMADRAAAIESVQTRFGTIAGELGLDGDPAV
FT                   AYRPRSRAADAGGLEEELAERHASDLERGFTQHGPHRDDLALTRERRELRAYGSQGQQR
FT                   LTLLALLLAEREAIAATRDAVPVMLLDDVMSELDRERRGRLVELLRGVGQSVITTTDLE
FT                   HVPGAEGADVTRLSVRDGVVGADAQTERAA"
     atgcggatcg tgcgcctcgc actgcgcaac ttccgcagct acccgaccgc cgaggtggag        60
     ctgggcgccg gactgacggt cgtctccggc cgcaacggcg ccggcaagac gaacctgctc       120
     gacgcgctct acttcggctg cacgggccgg tcggcgcgga cgaccaacga ccgcgagctg       180
     gtccgcttcg gcgagcaggt gacgcgcgtc gtggtcatga cagaggccga cgacggcgcg       240
     cacgagctga gcgtcgcgtt cgagtcgggg cagccgaagc gtctgatggc cgacggcgtc       300
     cgcgtcgagc gcctgctcga cgtccccggc cgaccgctcg tcagcgtctt tctgcccgat       360
     cggctggagc tggtgaaggg cacgccgtcg ctgcggcgcg cgcacatcga ccaggtcgtc       420
     gccgcgctgt ggcccgcgcg ggcggcgacc cgccgcgcct atgcacaggc gctggcgcag       480
     cggaacgcgc tcgtcgcgcg gatccgcgcg ggcggcgcct ccgcggcgtc gctgccggcg       540
     tgggaccgcg agctggcgcg ccacggagtc gcgctgatgg ccgatcgcgc cgcggcgatc       600
     gagtcggtgc agacgcgctt cggcacgatc gcgggcgagc tgggcctcga cggcgatccc       660
     gccgtcgcct accggccgcg gtcgagagcg gcggacgccg gcggtctgga ggaggagctg       720
     gcggagcggc acgcgagcga cctcgaacgc ggcttcacgc agcacggtcc gcaccgcgac       780
     gacctcgcgc tcacgcgcga gagacgggag ctgcgcgcat acggctccca gggccagcag       840
     cggctgacgc tgctcgcgct gctgctggcc gagcgggagg cgatcgcggc gacgcgcgac       900
     gccgtgcccg tgatgctgct cgacgacgtc atgagcgagc tggacagaga gcgccgcggc       960
     cggctcgtcg agctgctgcg cggcgtcggg cagagcgtga tcacgacgac cgacctcgaa      1020
     cacgtgcccg gggcggaggg cgcggacgtg acgcgtctga gcgtccgcga cggcgtggtc      1080
     ggcgccgacg ctcagacgga gcgcgcggcg tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page