(data stored in ACNUC7421 zone)

EMBL: CP001854.PE30

CP001854.PE30        Location/Qualifiers
FT   CDS_pept        31559..33952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0030"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: acp:A2cp1_2617 glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48466"
FT                   /db_xref="GOA:D3F3Y3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48466.1"
FT                   /translation="MAPRPLNGSTPPLQAQAAALLRRGDVDAYRALFADAAALEDRNAR
FT                   YLERCHLVNAALAHGGVGAAVGVRAGLEELLTVLEQEPAEPVLLNQAGVLLAMFDGFAP
FT                   ALAVLEAALRLDPGLDDVAVNAAKIRQLLSARTRGRIDRSGELGRRAARVAARAMPAEG
FT                   MTVSLCMIVKDEEEMLPRSLAAAAPAVDEIVVVDTGSSDRTIEIATSYGARVIERPWTG
FT                   SFSEARNVGLDAATGDWLLILDADEVLVADDVPNLRALLGRTWREAFYVSAINHTGELD
FT                   DGTATTHSTVRLFRNRPGHRYSGRLHEQIVESLPQGAPERFEATPVRIEHFGYLGAVRD
FT                   AKEKSRRNIELLERQRDEGDSSAFMHFNLGSEYGALGDAEAALAEYERAVALLGDVAGG
FT                   SGFIGALTSRHVRALRVCGRGDDAIARAEEALERFPGFTDLVFEQAAAAQALGRTDDAI
FT                   AYFERCIAMGDAPSRYTATVGMGTYLPTIALAEIRHQHGDPAAAVELLDGALAAHPGFF
FT                   GLVLPFAAALLDDGAEPDVVVARVEELVAKLTPTVRFMLGTALYEHGETEAAEQQYREL
FT                   LAQQPSSGHARVALAEALLSQRRWDEAAAVAAELNDAEPHAGAARRSELFARITGGDHT
FT                   GAAAVLARPEPDDAVVLGPGDRALFAAWLAAAGGEREDSVLPAEAVGLLAVTLEALLRV
FT                   EEVDAFGTLVGLLDRCPIAPREQRELRAGMYLRRGFLASAAEEWLAVCGADATDVRALV
FT                   GLAQVAVAQGMTDEALDFAREAHALDPGDARATRLLQRLEPLAA"
     atggcaccgc gtcctctcaa cggctcgacc ccaccgctcc aggcacaggc cgccgcgctc        60
     ctgcggcgcg gcgacgtcga cgcctatcgg gcgctgttcg ccgacgcggc cgcgttggag       120
     gatcgcaacg cccgatacct cgagcgctgc cacctcgtca acgcggcgct ggcgcacggc       180
     ggcgtcggcg cagccgtcgg cgttcgcgcg ggcctcgagg agctgctcac ggtgctggag       240
     caggagccgg ccgagccggt gctgctcaac caggctgggg tgctgctcgc gatgttcgac       300
     ggcttcgcac ccgcgctggc ggtgctggag gcggcgctgc gactcgaccc cggactggac       360
     gacgtcgccg tcaacgccgc caagatccgg cagctgctgt cagcgcgcac gcgcggccgg       420
     atcgaccgct ccggcgagct gggccggcgc gccgcgcgcg tcgccgcgcg cgccatgccg       480
     gccgagggca tgacggtcag cctctgcatg atcgtcaagg acgaggagga gatgctgccg       540
     cgctcgctcg ccgcggccgc gcccgccgtc gacgagatcg tcgtcgtcga caccggctcc       600
     agcgaccgca cgatcgagat cgccacgtcg tacggagcgc gcgtgatcga gcggccgtgg       660
     accggctcgt tctcggaggc gcgcaacgtc ggcctcgacg cggcgaccgg cgactggctg       720
     ctgatcctcg acgccgacga ggtgctcgtc gccgacgacg tgccgaacct gcgcgcgctg       780
     ctgggccgga cctggcgcga ggcgttctac gtctccgcga tcaaccacac gggcgagctc       840
     gacgacggca ccgcgaccac gcacagcacg gtgcggctgt tccgcaaccg ccccggccac       900
     cgctacagcg ggcgcctgca cgagcagatc gtcgagtcgc tgccgcaggg cgctcccgag       960
     cggttcgagg cgacgccggt ccgcatcgag cacttcggct acctcggcgc cgtgcgcgac      1020
     gcgaaggaga agtcgcgccg caacatcgag ctgctggagc ggcagcgcga cgagggcgac      1080
     agctcagcgt tcatgcactt caacctcggg tccgagtacg gcgcgctcgg cgacgcggag      1140
     gcggcgctgg cggagtacga gcgcgcggtc gcgctgctgg gcgacgtcgc cggcggctcc      1200
     ggcttcatcg gcgcgctgac cagccgtcac gtgcgtgcgc tgcgcgtctg cggccgcggc      1260
     gacgacgcga tcgcgcgggc ggaggaggcg ctggagcgct tccccggctt caccgacctc      1320
     gtcttcgagc aggccgccgc cgcgcaggca ctcgggcgca ccgacgacgc gatcgcctac      1380
     ttcgagcgct gcatcgcgat gggcgacgcg ccgagcagat acaccgcgac cgtcggcatg      1440
     ggcacctacc tgccgacgat cgcgctcgcc gagatccgcc accagcacgg cgatcccgcc      1500
     gccgccgtcg agctgctcga cggcgcgctc gccgcccacc ccggcttctt cggcctcgtg      1560
     ctgccgttcg ccgcggcgct gctcgacgac ggtgccgagc cggacgtcgt cgtcgcgcgg      1620
     gtggaggagc tggtcgcgaa gctgacgccg accgtgcgct tcatgctcgg cacggcgctg      1680
     tacgagcacg gcgagacgga ggcggccgag cagcagtacc gcgagctgct ggcgcagcag      1740
     ccgagcagcg gccacgcgcg cgtcgcgctt gcggaggcgc tgctgtcgca gcggcgctgg      1800
     gacgaggccg cggccgtcgc cgccgagctg aacgatgccg agccgcacgc cggggccgcc      1860
     cgccgcagcg agctgttcgc gcggatcacg ggcggggacc acaccggtgc cgccgccgtg      1920
     ctcgcgcgcc cggagccgga cgatgcggtc gtcctcgggc ccggcgaccg cgcgctgttc      1980
     gccgcctggc tcgccgccgc cggcggcgag cgcgaggaca gcgtgctgcc ggcggaggcg      2040
     gtcggcctgc tcgccgtcac gctggaggcg ctgctgcggg tggaggaggt cgacgcgttc      2100
     gggacgctcg tcgggctgct cgaccgctgt ccgatcgcgc cgcgcgagca gcgtgagctg      2160
     cgcgccggga tgtacctgcg ccggggcttt ctcgcctcgg ccgcggagga gtggctcgcg      2220
     gtctgcggtg ccgacgcaac cgacgtgcgc gcgctggtcg ggctcgcgca ggtcgccgtc      2280
     gcgcagggca tgaccgacga ggcgctcgac ttcgcgcgtg aggcccacgc gctcgatccg      2340
     ggagacgcgc gtgccacgcg actgctgcag cgactcgagc cgttggcggc gtag            2394
//

If you have problems or comments...

PBIL Back to PBIL home page