(data stored in ACNUC7421 zone)

EMBL: CP001854.PE31

CP001854.PE31        Location/Qualifiers
FT   CDS_pept        34080..34415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0031"
FT                   /product="flagellin FlaG, putative"
FT                   /note="KEGG: dvl:Dvul_1637 flagellin FlaG, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48467"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y4"
FT                   /inference="similar to AA sequence:KEGG:Dvul_1637"
FT                   /protein_id="ADB48467.1"
FT                   /translation="MSLDVAPVGPSSFSAANDAQPSSRAQRPAAVVRQQVEVDVIPESP
FT                   PREVLDAIDAASRAYQKLRAQGRELHFAQDADSGRLTIEVRDLDGKLLRMIPPSRLLDV
FT                   ATGGTLD"
     atgagcctgg acgtcgcgcc agtcggaccg agcagcttca gcgcagcgaa tgacgcacag        60
     ccgtcgtcgc gcgcgcagcg tccggctgct gtcgtgcgtc agcaggtgga ggtcgacgtc       120
     atccccgaga gccctccacg cgaggtgctc gacgcgatcg acgccgcgtc cagggcgtac       180
     cagaagctgc gcgcgcaagg acgcgagctg cacttcgcgc aggacgccga cagcggtcgg       240
     ctgacgatcg aggtccgtga cctcgacggc aagctcctgc gcatgattcc gccgagcaga       300
     ctgctcgacg tcgcaaccgg agggactctc gactaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page