(data stored in ACNUC7421 zone)

EMBL: CP001854.PE32

CP001854.PE32        Location/Qualifiers
FT   CDS_pept        34415..35842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0032"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellar hook-associated protein 2 domain protein; KEGG:
FT                   gsu:GSU3037 flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48468"
FT                   /db_xref="GOA:D3F3Y5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y5"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADB48468.1"
FT                   /translation="MAGINFSGIASGLNTGEIIEQMMAIEKRPRILLDNKQVLIETKQG
FT                   LLRDFQTKLRALQLAATDLRSVSLWTQTQSVESSDATKVSASSTSGAGVGGYQIEVSQL
FT                   ANAAQRTYTFTRPAADGTITVDGHSTAIRAGMTAQEVATAINTDRDAKVYAAATDDGTL
FT                   VLSSRATGDTGAGFIDVTSDGGAIAAKLDRGGARIERQGRDALYTLDGVSLRSSSNVIR
FT                   DGLAGVTLTLRGVTTASGPVTISVGAPGANVEAIRRKLEAFVEAYNATIDLIRGKLEER
FT                   TVPDPRSQQDIKNGVADPRTTAQKKAGTLFGDRQLAGMLSDLRQGIYSPVSGLPTGMDS
FT                   LSSIGISTGAFSASTSRDTLAGRLTIDTDRLTKALTEDPTGVRNLLQGVNNTDGWARRF
FT                   EGLLNDRTKSDGMLDNRIDGADDELRMLRRQMEQMDVRLALREKNLNAQFTALEVAISR
FT                   ARTQGDWLSGQLAGLNN"
     atggccggca tcaacttctc aggcatcgca tcgggcctca acaccggcga gatcatcgag        60
     cagatgatgg cgatcgagaa gcgcccgcgg atcctgctcg acaacaagca ggtgctgatc       120
     gagacgaagc aggggctgct gcgcgacttc cagacgaagc tcagagcgct gcagctcgcc       180
     gcgacggacc tgcgctcggt ctcgctgtgg acgcagacgc agtcggtcga gtcgagcgac       240
     gcgacgaagg tctccgcgtc cagcacctcg ggcgcgggcg tcggcggtta ccagatcgag       300
     gtctcccagc tcgcgaacgc cgctcagcgg acctacacct tcacgagacc tgccgccgac       360
     ggcacgatca cggtcgacgg ccactcgacc gcgatcagag cgggcatgac ggcgcaggag       420
     gtcgcgaccg cgatcaacac cgacagagac gcgaaggtgt acgcggccgc gaccgacgac       480
     ggcacgctcg tgctctcgag ccgcgcgacc ggggacaccg gcgccggctt catcgacgtc       540
     acgagcgacg gcggcgcgat cgcggccaag ctcgacagag gtggcgcgag aatcgagcgg       600
     cagggcagag acgcgctcta cacgctcgac ggcgtctcgc tgagatcgag cagcaacgtc       660
     atcagagacg gtctcgccgg cgtcacgctg acgctcagag gcgtcacgac cgcgagcggt       720
     ccggtcacga tctccgtcgg cgcgccgggc gcgaacgtcg aggcgatcag aagaaagctc       780
     gaggcgttcg tcgaggcgta caacgcgacg atcgacctga tccgcgggaa gctcgaagag       840
     agaacggtcc ccgacccgcg ctcgcagcag gacatcaaga acggcgtcgc ggacccgcgc       900
     acgacggcgc agaagaaggc cggcacgctg ttcggcgacc gccagctcgc gggcatgctg       960
     tccgacctgc gccaggggat ctactcgccc gtcagcgggc tgccgaccgg catggacagc      1020
     ctctcgtcga tcggcatctc gaccggtgcg ttctcggctt cgacgtcgag agacacgctc      1080
     gcgggcagac tcacgatcga caccgacaga ctgacgaagg cgctgaccga ggaccccacc      1140
     ggcgtccgca acctgctcca gggcgtcaac aacaccgacg gctgggcgcg ccgcttcgaa      1200
     gggctcctca acgaccgcac gaagtccgac ggcatgctcg acaatcggat cgacggcgcc      1260
     gacgacgagc tgagaatgct gcgccgccag atggagcaga tggacgtccg cctcgcgctg      1320
     cgagagaaga acctcaacgc gcagttcacc gcgctcgagg ttgcgatctc cagagccaga      1380
     acccagggcg actggctctc cggtcagctc gccggtctca acaactga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page