(data stored in ACNUC7421 zone)

EMBL: CP001854.PE33

CP001854.PE33        Location/Qualifiers
FT   CDS_pept        35937..36338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0033"
FT                   /product="flagellar protein FliS"
FT                   /note="TIGRFAM: flagellar protein FliS; PFAM: flagellar
FT                   protein FliS; KEGG: pca:Pcar_1111 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48469"
FT                   /db_xref="GOA:D3F3Y6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y6"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADB48469.1"
FT                   /translation="MSTHLAASPQAYRESAVLTAPPERLVVMLYDGAGRFLHQAVVTMR
FT                   AGDIQTCHERLRRAEAIIDHLLETLDMSQGEVAQQLESIYIFCQRLIAEARIRLDPEKL
FT                   EQVRGLLAELREAWDQIGTAGSGSQAAPA"
     atgagcaccc atctcgcggc atcgccgcag gcctatcgcg aaagcgcggt cctgaccgcg        60
     ccgccggagc ggctcgtcgt gatgctgtac gacggcgccg gccgcttcct gcaccaggcc       120
     gtggtcacga tgcgcgccgg cgacatccag acctgccacg aacgcctccg ccgcgccgag       180
     gcgatcatcg accacctgct cgagacgctc gacatgagcc agggcgaggt cgcgcagcag       240
     ctcgagtcga tctacatctt ctgccagcgg ctgatcgccg aagcgcgcat cagactcgac       300
     ccggagaagc tcgagcaggt cagaggcctg ctcgccgagc tgcgcgaggc gtgggaccag       360
     atcggcaccg ccggcagcgg gtcgcaggcc gcgcccgcat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page