(data stored in ACNUC7421 zone)

EMBL: CP001854.PE34

CP001854.PE34        Location/Qualifiers
FT   CDS_pept        36335..36667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48470"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48470.1"
FT                   /translation="MISAEPYEALAQLAERELALVSASEPPSAEALVALMAERDALVAS
FT                   LPARAPPAAAPALARALALQERITAELTVHAAQVRRTLGSVEHGRRTMHGYAGGAPARG
FT                   ALDLTG"
     atgatctccg ccgaaccgta cgaggcgctc gcccagctgg ccgagcgcga gctcgcgctc        60
     gtcagcgcga gcgagccgcc ctcggccgag gcgctcgtcg cgctgatggc cgagcgcgac       120
     gcgctggtcg cgtcgctgcc ggcgagagcg ccgcccgcgg ccgcccccgc gctcgcacgg       180
     gcgctcgcgc tgcaggagcg catcaccgcc gagctgaccg tccacgccgc gcaggtgcgg       240
     cggacgctcg gcagcgtcga gcacggccgc cgcacgatgc acgggtacgc cggcggcgcg       300
     cccgctcgcg gcgcgctcga cctgacgggt tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page