(data stored in ACNUC7421 zone)

EMBL: CP001854.PE35

CP001854.PE35        Location/Qualifiers
FT   CDS_pept        36745..37098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0035"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: flagellar basal body rod protein; KEGG:
FT                   ent:Ent638_1587 flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48471"
FT                   /db_xref="GOA:D3F3Y8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y8"
FT                   /inference="protein motif:TFAM:TIGR01396"
FT                   /protein_id="ADB48471.1"
FT                   /translation="MSLFDSTQLALESALRGSSMRQELLTNNLANINTPGYQRQDLDFH
FT                   SALQAAQASGNDPTEVTFRPSTDPSRVVRPDGSGLDADQESAALAKNTLEYQALVQVMG
FT                   ARTAIMQTALGVR"
     atgagtctct tcgacagcac ccagcttgcg ctcgagtccg ccctgcgcgg ctcctcgatg        60
     cgccaggagc tgctgacgaa caacctggcg aacatcaaca cgccgggcta tcagcgtcag       120
     gacctcgact tccactctgc cctgcaggcg gcgcaggcgt ccggcaacga cccgaccgag       180
     gtcaccttcc gcccgagcac ggatccgtcg cgcgtcgtgc gaccggacgg cagcggcctc       240
     gacgccgacc aggagtcggc ggcgctcgcg aagaacacgc tcgagtacca ggcgctcgtc       300
     caggtgatgg gcgcgcgcac cgcgatcatg cagaccgcgc tgggcgtgcg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page