(data stored in ACNUC7421 zone)

EMBL: CP001854.PE36

CP001854.PE36        Location/Qualifiers
FT   CDS_pept        37098..37547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0036"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: gsu:GSU0408
FT                   flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48472"
FT                   /db_xref="GOA:D3F3Y9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y9"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ADB48472.1"
FT                   /translation="MGLFDAIDIAGSGLTAERLRMDVTAENLANAQTTRAADGGPYQRK
FT                   EVVLQQSGGSSFSTMLTGAIGGVRASEASKGVEVAGIVEDQTAQRQVYDPGHPDADPRG
FT                   YVAMPNVNPVTEMVDLISSSRSYEANVTAMQSAKQMFTKTLELLR"
     atgggactgt tcgacgcgat cgacatcgcc ggcagcggcc tcaccgcgga gcgcctgcgg        60
     atggacgtca cggccgagaa cctcgccaac gcgcagacga cgcgcgctgc cgacggcggc       120
     ccgtaccagc gcaaggaggt cgtcctccag cagagcggcg gctcctcgtt ctcgacgatg       180
     ctcaccggcg cgatcggcgg cgtgcgcgcg agcgaggcgt ccaagggcgt cgaggtcgcc       240
     gggatcgtcg aggaccagac cgcgcagcgg caggtctacg accccgggca ccctgacgcg       300
     gacccgagag ggtacgtcgc gatgccgaac gtcaaccccg tgaccgagat ggtcgatctg       360
     atcagctcgt cgcgctccta cgaggcgaac gtgaccgcga tgcagtccgc caagcagatg       420
     ttcaccaaga cgctggagct gctcagatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page