(data stored in ACNUC7421 zone)

EMBL: CP001854.PE37

CP001854.PE37        Location/Qualifiers
FT   CDS_pept        37544..37909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0037"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: geo:Geob_0493 flagellar hook-basal body complex
FT                   subunit FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48473"
FT                   /db_xref="GOA:D3F3Z0"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z0"
FT                   /inference="protein motif:PFAM:PF02049"
FT                   /protein_id="ADB48473.1"
FT                   /translation="MIPAIDPSVVSGAGGAGGLGGEWQIQGVPDVPQAELLTPGVDGAQ
FT                   AGGGEGFGSMLANEIGKLSELQTHAAEAGQALATGTATDPVSAVVAVEKAQLAMQFAGQ
FT                   IRTRGAEALSEIFRTQI"
     atgatcccgg cgatcgatcc ctcggtcgtc tcgggcgccg gcggagccgg cgggctcggc        60
     ggcgaatggc agatccaggg cgtccccgac gtcccgcagg cggagctgct gacgcccggc       120
     gtcgacggcg ctcaggcggg cggcggcgaa ggattcggct cgatgctcgc gaacgagatc       180
     ggcaagctct ccgagctgca gacgcatgcc gccgaagcag gtcaggcgct cgcgaccggg       240
     acggcgaccg atccggtctc cgccgttgtg gccgtcgaga aggcgcagct cgcgatgcag       300
     ttcgcggggc agatccgcac gagaggcgcc gaggcgctct cagagatctt ccgcacccag       360
     atctag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page