(data stored in ACNUC7421 zone)

EMBL: CP001854.PE38

CP001854.PE38        Location/Qualifiers
FT   CDS_pept        37913..39430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0038"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rpa:RPA1264 flagellar MS-ring
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48474"
FT                   /db_xref="GOA:D3F3Z1"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z1"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ADB48474.1"
FT                   /translation="MPARALLANLSTRGKIVLAGGALAIVVVLFFLFQIATAPSYTTLL
FT                   TGMDPKDTGEVTAALDERGIAYELQNNGTALAVQKGQTAQARIALAGAGLPGNTNDGYK
FT                   ILDDQKMGTSNFQQNVNYQRALEGEIGTTIEEVDGVSSAQVQLVLPDREAQLFAENVNP
FT                   ATAAVLLSGASTLDEGQVRGIAQLVTNSVPGLKSEKVTITDSSGTMLWPTATSGSSSGL
FT                   LAKQAAEARYNQQTATNITAMLARTVGPDKVQVQVKADLDANEATQDRLVYGRDGTPLS
FT                   NRAERETLVSRGGRAGGPAGTAGNNPPVYAGQAGGDSDYRRESEDENLAVNKTVTRTRI
FT                   APGAVNRQQVAVLVDDSVPAAMLPQIRDAVMSAAGIDEDRGDVLTLGSIPFAELPRPAA
FT                   SSPVDDIWDYARYALLGMAALVFLALVARQLRKRENETLAGEPTWLREIESPRTLAELE
FT                   RFEEPVAPTQVLPLRSPENAARMQVEELVERDPERVAQHVRAWMQED"
     atgcccgcac gcgcactgct cgccaacctc tcgacccgcg gcaagatcgt cctcgccggc        60
     ggcgcgctcg cgatcgtcgt cgtgctcttc ttcctcttcc agatcgcgac ggcgccgagc       120
     tacacgacgc tgctgaccgg gatggacccg aaggacacgg gcgaggtcac ggccgcgctc       180
     gacgagagag gcatcgccta cgagctgcag aacaacggca ccgcgctcgc cgtccagaag       240
     ggccagaccg cgcaggcgcg gatcgcgctc gccggcgccg ggctgcccgg caatacgaac       300
     gacggctaca agatcctcga cgaccagaag atgggcacgt cgaacttcca gcagaacgtc       360
     aactaccagc gggcgctgga gggcgagatc gggacgacga tcgaggaggt cgacggcgtc       420
     tccagcgcgc aggtccagct ggtgctgccc gacagagagg cgcagctgtt cgccgagaac       480
     gtcaacccgg cgacggcggc ggtgctgctg tccggcgcga gcacgctcga cgagggccag       540
     gtgcgcggca tcgcccagct cgtcacgaac agcgtccccg gcctcaagtc cgagaaggtg       600
     acgatcaccg acagcagcgg cacgatgctg tggccgacgg cgacgagcgg cagctcctcc       660
     ggcctgctcg ccaagcaggc ggccgaggcg cgctacaacc agcagaccgc gaccaacatc       720
     accgcgatgc tcgcccgcac ggtcgggccc gacaaggtgc aggtacaggt caaggccgac       780
     ctcgacgcca acgaggcgac gcaggacaga ctcgtctacg gcagagacgg cacgccgctg       840
     tccaacagag ccgagagaga gacgctcgtc agcagaggcg gcagagcggg cggaccggcc       900
     ggcaccgccg gcaacaaccc gccggtctac gccggtcagg cgggcggcga ctccgactac       960
     agacgcgagt ccgaggacga gaacctcgcc gtcaacaaga ccgtcacgcg cacgagaatc      1020
     gcgcccggcg ccgtcaacag acagcaggtc gccgtgctcg tcgacgactc ggtcccggcc      1080
     gcgatgctgc cgcagatcag agacgccgtg atgagtgccg ccggcatcga cgaggaccgc      1140
     ggcgacgtgc tgacgctcgg ctccataccg ttcgccgagc tgccgagacc ggccgcttcc      1200
     tcgccggtcg acgacatctg ggactacgcc agatacgccc tcctcgggat ggccgcgctc      1260
     gtcttcctcg cgctcgtcgc gcggcagctg cgcaagcgcg agaacgagac gctcgcgggc      1320
     gagccgacgt ggctgcgcga gatcgagtcg ccgcgcacgc tcgcggagct ggagcggttc      1380
     gaggagccgg tcgcgccgac gcaggtgctg ccgctcagat cgcccgagaa cgcggcgcgg      1440
     atgcaggtcg aggagctcgt cgagcgcgat cccgagcggg tcgcgcagca cgtccgcgcg      1500
     tggatgcagg aggactga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page