(data stored in ACNUC7421 zone)

EMBL: CP001854.PE39

CP001854.PE39        Location/Qualifiers
FT   CDS_pept        39438..40520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0039"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG; KEGG: dvm:DvMF_2288
FT                   flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48475"
FT                   /db_xref="GOA:D3F3Z2"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z2"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ADB48475.1"
FT                   /translation="MAIQLPAAGTAEDPAGVMPAPRRLPQRTPVRLKGRNKAAVLLVAL
FT                   GPEKAAEIFKHLRDEEIETLSLEMAKLNQIDHEAVGFVFDELVATVQAYDSLAAGGVDY
FT                   ARDVLERALGPERAAEIIGRLSTVIEMRPFEFLRRTPPEHIVTFLRAEAPQTIALVIAN
FT                   LHTTLAAQVLAHLPEEEQADIALRIARMSETPPDVVKEIEGVMRQKLASVVQQEYSSQG
FT                   GVKSLAEILNYTDRPTERNVLDTLTEQDAELGEEVRRLLFVFEDIAKLDDRSIQLVLRE
FT                   ADQRDLALALRGVDDDVRERILGNMSERGATLLREEMEYQPPQRKRVVEEAQGRIVAIV
FT                   RRLEDAGALVIGRGGSDTIV"
     atggcgatcc aactcccagc cgctggcacg gccgaggacc cagccggcgt gatgccggcg        60
     ccgcggcgcc tcccgcagag aacgcccgtc cgcctcaagg gccgcaacaa ggccgccgtc       120
     ctgctcgtcg cgctcggccc cgagaaggcg gccgagatct tcaagcacct gcgcgacgag       180
     gagatcgaga cgctctcgct ggagatggcg aagctcaacc agatcgacca cgaggcggtc       240
     ggcttcgtct tcgacgagct ggtcgcgacg gtgcaggcgt acgactcgct cgccgccggc       300
     ggcgtcgact acgcgcgcga cgtgctggag cgcgcgctcg gccccgagcg tgccgccgag       360
     atcatcgggc ggctctcgac cgtgatcgag atgcggccgt tcgagttcct gcgccgcacg       420
     ccgcccgagc acatcgtcac gttcctgcgc gccgaggcgc cgcagacgat cgcgctcgtg       480
     atcgccaacc tgcacacgac gctcgccgcc caggtgctcg cgcacctgcc ggaggaggag       540
     caggccgaca tcgcgctgcg gatcgcgcgg atgagcgaga cgccgccgga cgtcgtgaag       600
     gagatcgagg gcgtgatgcg ccagaagctc gcgtctgtcg tgcagcagga gtactcgtcc       660
     cagggcggcg tcaagtcgct cgccgagatc ctcaactaca ccgaccggcc gaccgagcgc       720
     aacgtgctcg acacgctcac cgagcaggac gccgagctgg gcgaggaggt ccgccggctg       780
     ctgttcgtct tcgaggacat cgccaagctc gacgatcgct cgatccagct cgtgctgcgc       840
     gaggccgacc agagagatct ggcgctggcg ctgcgcggcg tcgacgacga cgtcagagag       900
     cggatcctcg gcaacatgtc cgagcgcggc gcgacgctgc tgcgcgagga gatggagtac       960
     cagccgccgc agcgcaagcg cgtcgtcgag gaggcgcagg gccgcatcgt cgcgatcgtg      1020
     cgacggctgg aggatgccgg cgcactcgtg atcggacgcg gtgggagcga caccattgtc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page