(data stored in ACNUC7421 zone)

EMBL: CP001854.PE4

CP001854.PE4         Location/Qualifiers
FT   CDS_pept        3800..4117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gme:Gmet_2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48440"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ7"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADB48440.1"
FT                   /translation="MSRRRAPRPLGEALGALQASLAPATLLAEVQRAWPAVAGEAIARE
FT                   AAPVSERGGTVTIACAAAVWAQELDLMAPMLIEKLNASIGRPAVKRLRCVTGAREGLRR
FT                   T"
     gtgagcagac gacgcgcgcc gcgaccgctc ggcgaggcgc tcggcgcgct gcaggcgtcg        60
     ctggcgccgg cgacgctgct ggccgaggtg cagcgcgcct ggccggccgt cgcgggggag       120
     gcgatcgcgc gcgaggcggc gcccgtgagc gagcgcggcg ggacggtcac gatcgcctgc       180
     gcggcggccg tctgggcgca ggagctcgat ctgatggcgc cgatgctgat cgaaaagctc       240
     aacgcctcga tcggccggcc ggcggtcaag cggctgcgtt gcgtgaccgg tgcgcgggaa       300
     ggtttgcgaa ggacgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page