(data stored in ACNUC7421 zone)

EMBL: CP001854.PE40

CP001854.PE40        Location/Qualifiers
FT   CDS_pept        40513..41130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0040"
FT                   /product="Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE"
FT                   /note="PFAM: Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE; KEGG: tbd:Tbd_1090 flagellar
FT                   assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48476"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z3"
FT                   /inference="protein motif:PFAM:PF02108"
FT                   /protein_id="ADB48476.1"
FT                   /translation="MSDPATAAPYAFRQLEEPRPVSLREIEDPIANAHAEAERIREEAR
FT                   AQGYADGQAAALAAAQPPLEAALAALQQAVAGVEQVRDETAAAVERDAIELSLQLAEKI
FT                   VAGALAVESERIVDVVRGALRRLAERRRVTILVHPDDLETVRAATESFVTGLGGIEHCE
FT                   VQAERRITPGGASVRTEEGQIDATVSTQLMRARELVELELGE"
     ttgtctgatc cggcgacggc cgctccgtac gccttccggc agctggagga gccgcgtccg        60
     gtctcgctgc gcgagatcga ggacccgatc gccaacgctc acgcggaggc cgagcggatc       120
     cgcgaggagg cgcgcgcgca gggctacgcc gacggtcagg ccgcggcgct cgccgccgcc       180
     cagccgccgc tggaggcggc gctcgccgcg ctgcagcagg cggtcgccgg cgtcgagcag       240
     gtgcgcgacg agacggccgc ggccgtcgag cgcgacgcga tcgagctgtc gctgcagctg       300
     gcggagaaga tcgtcgcggg cgcgctcgcg gtcgagtccg agcggatcgt cgacgtcgtg       360
     cgcggcgcgc tgcgccgcct cgccgagcgc cgccgcgtga cgatcctcgt ccaccccgac       420
     gacctcgaga cggtccgcgc cgcgaccgag tcgttcgtca ccggcctcgg cgggatcgag       480
     cactgcgagg tccaggccga gcggcggatc acgcccggcg gcgcgagcgt gcggaccgag       540
     gagggccaga tcgacgcgac cgtcagcacg cagctgatgc gcgcgcgaga gctggtcgag       600
     ctggagttgg gtgagtag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page