(data stored in ACNUC7421 zone)

EMBL: CP001854.PE41

CP001854.PE41        Location/Qualifiers
FT   CDS_pept        41141..42610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0041"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: dde:Dde_0350 ATPase FliI/YscN; TIGRFAM:
FT                   flagellar protein export ATPase FliI; ATPase, FliI/YscN
FT                   family; PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48477"
FT                   /db_xref="GOA:D3F3Z4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z4"
FT                   /inference="protein motif:TFAM:TIGR03496"
FT                   /protein_id="ADB48477.1"
FT                   /translation="MSPEDQTPDAVVAEQLGDRLKHVGNVLRASDLARRHGRVSDLIGL
FT                   VVEATGLQAEVGEICMVNGDRGHPPVPAEVVGFRGARTLLMPLGEMHGIGPATTTRATG
FT                   TPFRIRVGQDLLGRVIDGLGKPIDGMPRATNGHPRSTNASPPDPLDRPRIDQRVDLGVR
FT                   ALDALVPCGRGQRLGIFAGSGVGKSSLLGMIARSTTADVNVIALVGERGREVKEFVERD
FT                   LGDALSRSVVVVATSDQPALVRIKAAFTATAIAEHFRDQGNDVMLMMDSVTRFAMAQRE
FT                   VGLAIGEPPATRGYTPSVFAQLPRLLERSGTARTGSITGLYTVLVDGDDMNEPIADAVR
FT                   SILDGHVVLTRELAHASHYPAIDVLQSVSRLVGEIVSPEVRAAGQAVRQLMASYKEKED
FT                   LIAIGAYQGGTDPTVDAAIALRPQLDRFLKQRPDEKSSAAEADELLLDIAARIGEYAGV
FT                   GPEPAPADPAEQPASAPGGSAAAIPPLPNLA"
     atgagccccg aggaccagac accggacgcc gtcgtcgccg agcagctcgg cgaccgcctc        60
     aagcacgtcg gcaacgtcct gcgcgcgagc gacctcgcgc gccggcacgg ccgcgtcagc       120
     gacctgatcg ggctcgtcgt cgaggcgacc gggctgcagg ccgaggtcgg cgagatctgc       180
     atggtcaacg gcgaccgcgg ccacccgccg gtaccggcgg aggtcgtcgg cttccgcggt       240
     gcccgcacgc tgctgatgcc gctcggcgag atgcacggca tcggcccggc gacgaccacc       300
     cgcgcgaccg gcacgccgtt ccgcatccgc gtcggccagg acctgctcgg ccgcgtgatc       360
     gacgggctcg gcaagccgat cgacgggatg ccgcgcgcga ccaacggcca tccgcgttcg       420
     acgaacgcct cgccgccgga cccgctcgac cgcccccgca tcgaccagcg cgtcgacctc       480
     ggcgtgcgcg cgctcgacgc gctcgtgccg tgcggacgcg gccagcgcct cggcatcttc       540
     gccggctccg gcgtcggcaa gtcgtcgctg ctcggcatga tcgcccgctc gacgacggcg       600
     gacgtcaacg tgatcgcgct ggtcggcgag cgcggccgcg aggtgaagga gttcgtcgag       660
     cgtgacctcg gcgacgcgct gtcacgctcg gtcgtcgtcg tcgcgacctc cgaccagccg       720
     gcgctcgtcc gcatcaaggc cgcgttcacg gcgacggcga tcgccgagca cttccgtgac       780
     cagggcaacg acgtgatgct gatgatggac tccgtcacgc gcttcgcgat ggcccagcgc       840
     gaggtcggcc tggcgatcgg cgagccgccg gcgacgcgcg gctacacgcc gagcgtcttc       900
     gcccagctgc cgcgcctgct ggagcgctcc ggcaccgcca gaaccggctc gatcaccggc       960
     ctctacaccg tgctcgtcga cggcgacgac atgaacgagc cgatcgccga cgcggtccgc      1020
     tcgatcctcg acggtcacgt cgtgctgacg cgcgagctgg cgcacgcctc ccactacccc      1080
     gcgatcgacg tgctgcagag cgtctcccgc ctcgtcggcg agatcgtctc gccggaggtc      1140
     cgcgccgccg gccaggcggt ccgccagctg atggcctcct acaaggagaa ggaggacctg      1200
     atcgcgatcg gcgcctacca gggcggcacc gatccgacgg tcgacgccgc gatcgcgctg      1260
     cgccctcagc tcgaccgctt cctcaagcag cgcccggacg agaagtcgtc ggccgcggag      1320
     gccgacgagc tgctgctcga catcgccgcg cgcatcggcg agtacgccgg cgtcggtccc      1380
     gagccggccc ccgccgaccc ggccgagcag cccgcctccg ctcccggcgg ctccgccgcc      1440
     gcgataccgc cgctgccgaa cctcgcctga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page